easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

elenchical

pallu

endovasculitis

tremelline

questioningly

versabatisque

unthinker

nouamque

marshalled

laxabimusque

uralite

kosmos

blent

fucoxanthin

parodiable

teachest

dicque

cinenchyma


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: ceteri
cipher variations:
dfufsj egvgtk fhwhul gixivm hjyjwn
ikzkxo jlalyp kmbmzq lncnar modobs
npepct oqfqdu prgrev qshsfw rtitgx
sujuhy tvkviz uwlwja vxmxkb wynylc
xzozmd yapane zbqbof acrcpg bdsdqh

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: ceteri
Cipher: xvgvir

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: ceteri
Cipher: AAABA AABAA BAABA AABAA BAAAA ABAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: ceteri
cipher variations:
dfufsjhngnazlvsvippdedqftlqlyvxtctglfjajwrjrmreh
nzyzmxrhkhunvpwpcdzxixktegvgtkiohobamwtwjqqeferg
umrmzwyuduhmgkbkxsksnsfioazanysilivowqxqdeayjylu
fhwhuljpipcbnxuxkrrfgfshvnsnaxzvevinhlclytltotgj
pbaboztjmjwpxryrefbzkzmvgixivmkqjqdcoyvylssghgti
wotobyawfwjoimdmzumupuhkqcbcpauknkxqyszsfgcalanw
hjyjwnlrkredpzwzmtthihujxpupczbxgxkpjnenavnvqvil
rdcdqbvlolyrztatghdbmboxikzkxomslsfeqaxanuuijivk
yqvqdacyhylqkofobwowrwjmsedercwmpmzsaubuhiecncpy
jlalypntmtgfrbybovvjkjwlzrwrebdzizmrlpgpcxpxsxkn
tfefsdxnqnatbvcvijfdodqzkmbmzqounuhgsczcpwwklkxm
asxsfceajansmqhqdyqytylougfgteyorobucwdwjkgepera
lncnarpvovihtdadqxxlmlynbtytgdfbkbotnrirezrzuzmp
vhghufzpspcvdxexklhfqfsbmodobsqwpwjiueberyymnmzo
cuzuhegclcpuosjsfasavanqwihivgaqtqdweyfylmigrgtc
npepctrxqxkjvfcfszznonapdvavifhdmdqvptktgbtbwbor
xjijwhbrurexfzgzmnjhshudoqfqdusyrylkwgdgtaaopobq
ewbwjgienerwquluhcucxcpsykjkxicsvsfygahanokitive
prgrevtzszmlxhehubbpqpcrfxcxkhjfofsxrvmvidvdydqt
zlklyjdtwtgzhbibopljujwfqshsfwuatanmyifivccqrqds
gydylikgpgtyswnwjewezeruamlmzkeuxuhaicjcpqmkvkxg
rtitgxvbubonzjgjwddrsrethzezmjlhqhuztxoxkfxfafsv
bnmnalfvyvibjdkdqrnlwlyhsujuhywcvcpoakhkxeestsfu
iafankmirivauypylgygbgtwconobmgwzwjckelersomxmzi
tvkvizxdwdqpblilyfftutgvjbgbolnjsjwbvzqzmhzhchux
dpopcnhxaxkdlfmfstpnynajuwlwjayexerqcmjmzgguvuhw
kchcpmoktkxcwaraniaidivyeqpqdoiybylemgngtuqozobk
vxmxkbzfyfsrdnknahhvwvixldidqnplulydxbsbojbjejwz
frqrepjzczmfnhohuvrpapclwynylcagzgtseolobiiwxwjy
mejeroqmvmzeyctcpkckfkxagsrsfqkadangoipivwsqbqdm
xzozmdbhahutfpmpcjjxyxkznfkfsprnwnafzdudqldlglyb
htstgrlbebohpjqjwxtrcrenyapanecibivugqnqdkkyzyla
oglgtqsoxobgaevermemhmzciutuhsmcfcpiqkrkxyusdsfo
zbqbofdjcjwvhrorellzazmbphmhurtpypchbfwfsnfninad
jvuvitndgdqjrlslyzvtetgpacrcpgekdkxwispsfmmabanc
qinivsuqzqdicgxgtogojobekwvwjuoeherksmtmzawufuhq
bdsdqhflelyxjtqtgnnbcbodrjojwtvrarejdhyhuphpkpcf
lxwxkvpfifsltnunabxvgvirceterigmfmzykuruhoocdcpe
skpkxuwsbsfkeizivqiqlqdgmyxylwqgjgtmuovobcywhwjs

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: ceteri
Cipher: prgrev

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: ceteri
Cipher: 315144512442

Extended Methods:
Method #1

Plaintext: ceteri
method variations:
hkykwonpdpbtsuiugyxzozmd

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c e t e r i 
3 5 4 5 2 4 
1 1 4 1 4 2 
They are then read out in rows:
354524114142
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: ceteri
Cipher: xyradi

Read more ...
Method #3

Plaintext: ceteri
method variations:
vqyftm qyftmv yftmvq
ftmvqy tmvqyf mvqyft

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: ceteri

all 720 cipher variations:
ceteri ceteir cetrei cetrie cetire cetier ceetri ceetir ceerti ceerit ceeirt
ceeitr cereti cereit certei certie cerite ceriet ceiert ceietr ceiret ceirte
ceitre ceiter cteeri cteeir cterei cterie cteire cteier cteeri cteeir cterei
cterie cteire cteier ctreei ctreie ctreei ctreie ctriee ctriee ctiere ctieer
ctiree ctiree ctiere ctieer ceteri ceteir cetrei cetrie cetire cetier ceetri
ceetir ceerti ceerit ceeirt ceeitr cereti cereit certei certie cerite ceriet
ceiert ceietr ceiret ceirte ceitre ceiter crteei crteie crteei crteie crtiee
crtiee cretei cretie creeti creeit creiet creite creeti creeit cretei cretie
creite creiet crieet criete crieet criete critee critee citere citeer citree
citree citere citeer cietre cieter cierte cieret cieert cieetr cirete cireet
cirtee cirtee cirete cireet cieert cieetr cieret cierte cietre cieter ecteri
ecteir ectrei ectrie ectire ectier ecetri ecetir ecerti ecerit eceirt eceitr
ecreti ecreit ecrtei ecrtie ecrite ecriet eciert ecietr eciret ecirte ecitre
eciter etceri etceir etcrei etcrie etcire etcier etecri etecir eterci eteric
eteirc eteicr etreci etreic etrcei etrcie etrice etriec etierc etiecr etirec
etirce eticre eticer eetcri eetcir eetrci eetric eetirc eeticr eectri eectir
eecrti eecrit eecirt eecitr eercti eercit eertci eertic eeritc eerict eeicrt
eeictr eeirct eeirtc eeitrc eeitcr erteci erteic ertcei ertcie ertice ertiec
eretci eretic erecti erecit ereict ereitc erceti erceit erctei erctie ercite
erciet eriect erietc ericet ericte eritce eritec eiterc eitecr eitrec eitrce
eitcre eitcer eietrc eietcr eiertc eierct eiecrt eiectr eiretc eirect eirtec
eirtce eircte eircet eicert eicetr eicret eicrte eictre eicter teceri teceir
tecrei tecrie tecire tecier teecri teecir teerci teeric teeirc teeicr tereci
tereic tercei tercie terice teriec teierc teiecr teirec teirce teicre teicer
tceeri tceeir tcerei tcerie tceire tceier tceeri tceeir tcerei tcerie tceire
tceier tcreei tcreie tcreei tcreie tcriee tcriee tciere tcieer tciree tciree
tciere tcieer teceri teceir tecrei tecrie tecire tecier teecri teecir teerci
teeric teeirc teeicr tereci tereic tercei tercie terice teriec teierc teiecr
teirec teirce teicre teicer trceei trceie trceei trceie trciee trciee trecei
trecie treeci treeic treiec treice treeci treeic trecei trecie treice treiec
trieec triece trieec triece tricee tricee ticere ticeer ticree ticree ticere
ticeer tiecre tiecer tierce tierec tieerc tieecr tirece tireec tircee tircee
tirece tireec tieerc tieecr tierec tierce tiecre tiecer eetcri eetcir eetrci
eetric eetirc eeticr eectri eectir eecrti eecrit eecirt eecitr eercti eercit
eertci eertic eeritc eerict eeicrt eeictr eeirct eeirtc eeitrc eeitcr etecri
etecir eterci eteric eteirc eteicr etceri etceir etcrei etcrie etcire etcier
etrcei etrcie etreci etreic etriec etrice eticre eticer etirce etirec etierc
etiecr ecteri ecteir ectrei ectrie ectire ectier ecetri ecetir ecerti ecerit
eceirt eceitr ecreti ecreit ecrtei ecrtie ecrite ecriet eciert ecietr eciret
ecirte ecitre eciter ertcei ertcie erteci erteic ertiec ertice erctei erctie
erceti erceit erciet ercite erecti erecit eretci eretic ereitc ereict ericet
ericte eriect erietc eritec eritce eitcre eitcer eitrce eitrec eiterc eitecr
eictre eicter eicrte eicret eicert eicetr eircte eircet eirtce eirtec eiretc
eirect eiecrt eiectr eierct eiertc eietrc eietcr reteci reteic retcei retcie
retice retiec reetci reetic reecti reecit reeict reeitc receti receit rectei
rectie recite reciet reiect reietc reicet reicte reitce reitec rteeci rteeic
rtecei rtecie rteice rteiec rteeci rteeic rtecei rtecie rteice rteiec rtceei
rtceie rtceei rtceie rtciee rtciee rtiece rtieec rticee rticee rtiece rtieec
reteci reteic retcei retcie retice retiec reetci reetic reecti reecit reeict
reeitc receti receit rectei rectie recite reciet reiect reietc reicet reicte
reitce reitec rcteei rcteie rcteei rcteie rctiee rctiee rcetei rcetie rceeti
rceeit rceiet rceite rceeti rceeit rcetei rcetie rceite rceiet rcieet rciete
rcieet rciete rcitee rcitee ritece riteec ritcee ritcee ritece riteec rietce
rietec riecte riecet rieect rieetc ricete riceet rictee rictee ricete riceet
rieect rieetc riecet riecte rietce rietec ieterc ietecr ietrec ietrce ietcre
ietcer ieetrc ieetcr ieertc ieerct ieecrt ieectr ieretc ierect iertec iertce
iercte iercet iecert iecetr iecret iecrte iectre iecter iteerc iteecr iterec
iterce itecre itecer iteerc iteecr iterec iterce itecre itecer itreec itrece
itreec itrece itrcee itrcee itcere itceer itcree itcree itcere itceer ieterc
ietecr ietrec ietrce ietcre ietcer ieetrc ieetcr ieertc ieerct ieecrt ieectr
ieretc ierect iertec iertce iercte iercet iecert iecetr iecret iecrte iectre
iecter irteec irtece irteec irtece irtcee irtcee iretec iretce ireetc ireect
irecet irecte ireetc ireect iretec iretce irecte irecet irceet ircete irceet
ircete irctee irctee ictere icteer ictree ictree ictere icteer icetre iceter
icerte iceret iceert iceetr icrete icreet icrtee icrtee icrete icreet iceert
iceetr iceret icerte icetre iceter

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us