easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

transjordanian

dreadly

rabbindom

decore

bandova

brume

mesologic

acceptis

resistissetque

adstabunt

tahir

fervorless

declaraverintque

fouch

abeyancy

sierracity

forestland

vintila


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: casses
cipher variations:
dbttft ecuugu fdvvhv gewwiw hfxxjx
igyyky jhzzlz kiaama ljbbnb mkccoc
nlddpd omeeqe pnffrf qoggsg rphhth
sqiiui trjjvj uskkwk vtllxl wummym
xvnnzn ywooao zxppbp ayqqcq bzrrdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: casses
Cipher: xzhhvh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: casses
Cipher: AAABA AAAAA BAAAB BAAAB AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: casses
cipher variations:
dbttfthbddndlbnnvnpbxxdxtbhhlhxbrrtrfblljljbvvrv
nbffzfrbpphpvbzzpzzbjjxjecuuguiceeoemcoowoqcyyey
uciimiycssusgcmmkmkcwwswocggagscqqiqwcaaqaackkyk
fdvvhvjdffpfndppxprdzzfzvdjjnjzdttvthdnnlnldxxtx
pdhhbhtdrrjrxdbbrbbdllzlgewwiwkeggqgoeqqyqseaaga
wekkokaeuuwuieoomomeyyuyqeiiciuessksyeccsccemmam
hfxxjxlfhhrhpfrrzrtfbbhbxfllplbfvvxvjfppnpnfzzvz
rfjjdjvfttltzfddtddfnnbnigyykymgiisiqgssasugccic
ygmmqmcgwwywkgqqoqogaawasgkkekwguumuageeueegooco
jhzzlznhjjtjrhttbtvhddjdzhnnrndhxxzxlhrrprphbbxb
thllflxhvvnvbhffvffhppdpkiaamaoikkuksiuucuwieeke
aioosoeiyyaymissqsqiccycuimmgmyiwwowciggwggiqqeq
ljbbnbpjllvltjvvdvxjfflfbjpptpfjzzbznjttrtrjddzd
vjnnhnzjxxpxdjhhxhhjrrfrmkccocqkmmwmukwwewykggmg
ckqquqgkaacaokuususkeeaewkooioakyyqyekiiyiikssgs
nlddpdrlnnxnvlxxfxzlhhnhdlrrvrhlbbdbplvvtvtlffbf
xlppjpblzzrzfljjzjjltthtomeeqesmooyowmyygyamiioi
emsswsimccecqmwwuwumggcgymqqkqcmaasagmkkakkmuuiu
pnffrftnppzpxnzzhzbnjjpjfnttxtjnddfdrnxxvxvnhhdh
znrrlrdnbbtbhnllbllnvvjvqoggsguoqqaqyoaaiacokkqk
gouuyukoeegesoyywywoiieiaossmseoccuciommcmmowwkw
rphhthvprrbrzpbbjbdpllrlhpvvzvlpffhftpzzxzxpjjfj
bpttntfpddvdjpnndnnpxxlxsqiiuiwqsscsaqcckceqmmsm
iqwwawmqggiguqaayayqkkgkcquuougqeewekqooeooqyymy
trjjvjxrttdtbrddldfrnntnjrxxbxnrhhjhvrbbzbzrllhl
drvvpvhrffxflrppfpprzznzuskkwkysuueucseemegsoouo
ksyycyosiikiwsccacasmmimeswwqwisggygmsqqgqqsaaoa
vtllxlztvvfvdtffnfhtppvpltzzdzptjjljxtddbdbtnnjn
ftxxrxjthhzhntrrhrrtbbpbwummymauwwgweuggogiuqqwq
muaaeaqukkmkyueececuookoguyysykuiiaioussissuccqc
xvnnznbvxxhxfvhhphjvrrxrnvbbfbrvllnlzvffdfdvpplp
hvzztzlvjjbjpvttjttvddrdywooaocwyyiygwiiqikwssys
owccgcswmmomawggegewqqmqiwaauamwkkckqwuukuuweese
zxppbpdxzzjzhxjjrjlxttztpxddhdtxnnpnbxhhfhfxrrnr
jxbbvbnxlldlrxvvlvvxfftfayqqcqeyaakaiykkskmyuuau
qyeeieuyooqocyiigigyssoskyccwcoymmemsywwmwwyggug
bzrrdrfzbblbjzlltlnzvvbvrzffjfvzpprpdzjjhjhzttpt
lzddxdpznnfntzxxnxxzhhvhcassesgaccmckammumoawwcw
saggkgwaqqsqeakkikiauuqumaeeyeqaoogouayyoyyaiiwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: casses
Cipher: pnffrf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: casses
Cipher: 311134345134

Extended Methods:
Method #1

Plaintext: casses
method variations:
hfxxkxnlccpcsqhhuhxvnnzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c a s s e s 
3 1 3 3 5 3 
1 1 4 4 1 4 
They are then read out in rows:
313353114414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: casses
Cipher: cnpatq

Read more ...
Method #3

Plaintext: casses
method variations:
aloylo loyloa oyloal
yloalo loaloy oaloyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: casses

all 720 cipher variations:
casses cassse casess casess casses cassse casses cassse casess casess casses
cassse caesss caesss caesss caesss caesss caesss casses cassse casess casess
casses cassse csases csasse csaess csaess csases csasse cssaes cssase csseas
cssesa csssea csssae csesas csessa cseass cseass csesas csessa csssea csssae
cssesa csseas cssaes cssase cssaes cssase csseas cssesa csssea csssae csases
csasse csaess csaess csases csasse cseass cseass csesas csessa csessa csesas
cssaes cssase csseas cssesa csssea csssae cessas cesssa cesass cesass cessas
cesssa cessas cesssa cesass cesass cessas cesssa ceasss ceasss ceasss ceasss
ceasss ceasss cessas cesssa cesass cesass cessas cesssa csssea csssae cssesa
csseas cssaes cssase csssea csssae cssesa csseas cssaes cssase csessa csesas
csessa csesas cseass cseass csases csasse csaess csaess csases csasse acsses
acssse acsess acsess acsses acssse acsses acssse acsess acsess acsses acssse
acesss acesss acesss acesss acesss acesss acsses acssse acsess acsess acsses
acssse ascses ascsse ascess ascess ascses ascsse assces asscse assecs assesc
asssec asssce asescs asessc asecss asecss asescs asessc asssec asssce assesc
assecs assces asscse assces asscse assecs assesc asssec asssce ascses ascsse
ascess ascess ascses ascsse asecss asecss asescs asessc asessc asescs assces
asscse assecs assesc asssec asssce aesscs aesssc aescss aescss aesscs aesssc
aesscs aesssc aescss aescss aesscs aesssc aecsss aecsss aecsss aecsss aecsss
aecsss aesscs aesssc aescss aescss aesscs aesssc asssec asssce assesc assecs
assces asscse asssec asssce assesc assecs assces asscse asessc asescs asessc
asescs asecss asecss ascses ascsse ascess ascess ascses ascsse sacses sacsse
sacess sacess sacses sacsse sasces sascse sasecs sasesc sassec sassce saescs
saessc saecss saecss saescs saessc sassec sassce sasesc sasecs sasces sascse
scases scasse scaess scaess scases scasse scsaes scsase scseas scsesa scssea
scssae scesas scessa sceass sceass scesas scessa scssea scssae scsesa scseas
scsaes scsase sscaes sscase ssceas sscesa sscsea sscsae ssaces ssacse ssaecs
ssaesc ssasec ssasce sseacs sseasc ssecas ssecsa ssesca ssesac sssaec sssace
ssseac ssseca ssscea ssscae secsas secssa secass secass secsas secssa sescas
sescsa sesacs sesasc sessac sessca seascs seassc seacss seacss seascs seassc
sessac sessca sesasc sesacs sescas sescsa sscsea sscsae sscesa ssceas sscaes
sscase ssscea ssscae ssseca ssseac sssaec sssace ssesca ssesac ssecsa ssecas
sseacs sseasc ssasec ssasce ssaesc ssaecs ssaces ssacse sasces sascse sasecs
sasesc sassec sassce sacses sacsse sacess sacess sacses sacsse saecss saecss
saescs saessc saessc saescs sasces sascse sasecs sasesc sassec sassce ssaces
ssacse ssaecs ssaesc ssasec ssasce sscaes sscase ssceas sscesa sscsea sscsae
ssecas ssecsa sseacs sseasc ssesac ssesca ssscea ssscae ssseca ssseac sssaec
sssace scsaes scsase scseas scsesa scssea scssae scases scasse scaess scaess
scases scasse sceass sceass scesas scessa scessa scesas scsaes scsase scseas
scsesa scssea scssae sescas sescsa sesacs sesasc sessac sessca secsas secssa
secass secass secsas secssa seacss seacss seascs seassc seassc seascs sescas
sescsa sesacs sesasc sessac sessca ssscea ssscae ssseca ssseac sssaec sssace
sscsea sscsae sscesa ssceas sscaes sscase ssecsa ssecas ssesca ssesac sseasc
sseacs ssaces ssacse ssaecs ssaesc ssasec ssasce easscs easssc eascss eascss
easscs easssc easscs easssc eascss eascss easscs easssc eacsss eacsss eacsss
eacsss eacsss eacsss easscs easssc eascss eascss easscs easssc esascs esassc
esacss esacss esascs esassc essacs essasc esscas esscsa esssca esssac escsas
escssa escass escass escsas escssa esssca esssac esscsa esscas essacs essasc
essacs essasc esscas esscsa esssca esssac esascs esassc esacss esacss esascs
esassc escass escass escsas escssa escssa escsas essacs essasc esscas esscsa
esssca esssac ecssas ecsssa ecsass ecsass ecssas ecsssa ecssas ecsssa ecsass
ecsass ecssas ecsssa ecasss ecasss ecasss ecasss ecasss ecasss ecssas ecsssa
ecsass ecsass ecssas ecsssa esssca esssac esscsa esscas essacs essasc esssca
esssac esscsa esscas essacs essasc escssa escsas escssa escsas escass escass
esascs esassc esacss esacss esascs esassc sassec sassce sasesc sasecs sasces
sascse sassec sassce sasesc sasecs sasces sascse saessc saescs saessc saescs
saecss saecss sacses sacsse sacess sacess sacses sacsse ssasec ssasce ssaesc
ssaecs ssaces ssacse sssaec sssace ssseac ssseca ssscea ssscae ssesac ssesca
sseasc sseacs ssecas ssecsa sscsea sscsae sscesa ssceas sscaes sscase sssaec
sssace ssseac ssseca ssscea ssscae ssasec ssasce ssaesc ssaecs ssaces ssacse
sseasc sseacs ssesac ssesca ssecsa ssecas sscaes sscase ssceas sscesa sscsea
sscsae sessac sessca sesasc sesacs sescas sescsa sessac sessca sesasc sesacs
sescas sescsa seassc seascs seassc seascs seacss seacss secsas secssa secass
secass secsas secssa scssea scssae scsesa scseas scsaes scsase scssea scssae
scsesa scseas scsaes scsase scessa scesas scessa scesas sceass sceass scases
scasse scaess scaess scases scasse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us