easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

dianthuses

trebonius

subtersensual

abjuration

breeziness

budner

unbeguile

savitt

adgressus

jests

toxoplasmosis

nitpicked

baraca

weekender

annas

unshrunken

kulle

huckleback


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: caedererque
cipher variations:
dbfefsfsrvf ecgfgtgtswg fdhghuhutxh geihivivuyi hfjijwjwvzj
igkjkxkxwak jhlklylyxbl kimlmzmzycm ljnmnanazdn mkonobobaeo
nlpopcpcbfp omqpqdqdcgq pnrqreredhr qosrsfsfeis rptstgtgfjt
squtuhuhgku trvuvivihlv uswvwjwjimw vtxwxkxkjnx wuyxylylkoy
xvzyzmzmlpz ywazananmqa zxbabobonrb aycbcpcposc bzdcdqdqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: caedererque
Cipher: xzvwvivijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: caedererque
Cipher: AAABA AAAAA AABAA AAABB AABAA BAAAA AABAA BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: caedererque
cipher variations:
dbfefsfsrvfhbnknanaxjnlbvqvividxvpbdwdqdqjldtblclylypzlxbtitgtgvntfbjujwjwhpjjbrarerendr
nbzgzmzmtrzrbhmhuhuzfhvbpspcpcftpzbxyxkxklhxecgfgtgtswgicolobobykomcwrwjwjeywqcexererkme
ucmdmzmzqamycujuhuhwougckvkxkxiqkkcsbsfsfoesocahananusascinivivagiwcqtqdqdguqacyzylylmiy
fdhghuhutxhjdpmpcpczlpndxsxkxkfzxrdfyfsfslnfvdnenanarbnzdvkvivixpvhdlwlylyjrlldtctgtgpft
pdbibobovtbtdjojwjwbhjxdrurerehvrbdzazmzmnjzgeihivivuyikeqnqdqdamqoeytylylgaysegzgtgtmog
weofobobscoaewlwjwjyqwiemxmzmzksmmeuduhuhqguqecjcpcpwucuekpkxkxcikyesvsfsfiwsceabananoka
hfjijwjwvzjlfrorerebnrpfzuzmzmhbztfhahuhunphxfpgpcpctdpbfxmxkxkzrxjfnynanaltnnfvevivirhv
rfdkdqdqxvdvflqlylydjlzftwtgtgjxtdfbcboboplbigkjkxkxwakmgspsfsfcosqgavananicaugibivivoqi
ygqhqdqdueqcgynylylasykgozobobmuoogwfwjwjsiwsgelererywewgmrmzmzekmaguxuhuhkyuegcdcpcpqmc
jhlklylyxblnhtqtgtgdptrhbwbobojdbvhjcjwjwprjzhrirerevfrdhzozmzmbtzlhpapcpcnvpphxgxkxktjx
thfmfsfszxfxhnsnanaflnbhvyvivilzvfhdedqdqrndkimlmzmzycmoiuruhuhequsicxcpcpkecwikdkxkxqsk
aisjsfsfwgseiapanancuamiqbqdqdowqqiyhylylukyuigngtgtaygyiotobobgmociwzwjwjmawgieferersoe
ljnmnanazdnpjvsvivifrvtjdydqdqlfdxjlelylyrtlbjtktgtgxhtfjbqbobodvbnjrcrerepxrrjzizmzmvlz
vjhohuhubzhzjpupcpchnpdjxaxkxknbxhjfgfsfstpfmkonobobaeoqkwtwjwjgswukezerermgeykmfmzmzsum
ckuluhuhyiugkcrcpcpewcoksdsfsfqysskajananwmawkipivivcaiakqvqdqdioqekybylylocyikghgtgtuqg
nlpopcpcbfprlxuxkxkhtxvlfafsfsnhfzlngnanatvndlvmvivizjvhldsdqdqfxdpltetgtgrzttlbkboboxnb
xljqjwjwdbjblrwrerejprflzczmzmpdzjlhihuhuvrhomqpqdqdcgqsmyvylyliuywmgbgtgtoigamohobobuwo
emwnwjwjakwimeterergyeqmufuhuhsauumclcpcpyocymkrkxkxeckcmsxsfsfkqsgmadananqeakmijivivwsi
pnrqreredhrtnzwzmzmjvzxnhchuhupjhbnpipcpcvxpfnxoxkxkblxjnfufsfshzfrnvgvivitbvvndmdqdqzpd
znlslylyfdldntytgtglrthnbeboborfblnjkjwjwxtjqosrsfsfeisuoaxanankwayoidivivqkicoqjqdqdwyq
goypylylcmykogvgtgtiagsowhwjwjucwwoenereraqeaomtmzmzgemeouzuhuhmsuiocfcpcpsgcmoklkxkxyuk
rptstgtgfjtvpbybobolxbzpjejwjwrljdprkrerexzrhpzqzmzmdnzlphwhuhujbhtpxixkxkvdxxpfofsfsbrf
bpnunanahfnfpvavivintvjpdgdqdqthdnplmlylyzvlsqutuhuhgkuwqczcpcpmycaqkfkxkxsmkeqslsfsfyas
iqarananeoamqixivivkciuqyjylylweyyqgpgtgtcsgcqovobobigogqwbwjwjouwkqehereruieoqmnmzmzawm
trvuvivihlvxrdadqdqnzdbrlglylytnlfrtmtgtgzbtjrbsbobofpbnrjyjwjwldjvrzkzmzmxfzzrhqhuhudth
drpwpcpcjhphrxcxkxkpvxlrfifsfsvjfprnonanabxnuswvwjwjimwysebereroaecsmhmzmzuomgsunuhuhacu
ksctcpcpgqcoskzkxkxmekwsalananygaasiriviveuiesqxqdqdkiqisydylylqwymsgjgtgtwkgqsopobobcyo
vtxwxkxkjnxztfcfsfspbfdtninanavpnhtvovivibdvltdudqdqhrdptlalylynflxtbmbobozhbbtjsjwjwfvj
ftryrereljrjtzezmzmrxznthkhuhuxlhrtpqpcpcdzpwuyxylylkoyaugdgtgtqcgeuojobobwqoiuwpwjwjcew
muevererisequmbmzmzogmyucncpcpaiccuktkxkxgwkguszsfsfmkskuafanansyaouilivivymisuqrqdqdeaq
xvzyzmzmlpzbvhehuhurdhfvpkpcpcxrpjvxqxkxkdfxnvfwfsfsjtfrvncnanaphnzvdodqdqbjddvlulylyhxl
hvtatgtgnltlvbgbobotzbpvjmjwjwznjtvrsrerefbrywazananmqacwifivivseigwqlqdqdysqkwyrylylegy
owgxgtgtkugswodobobqioawepererckeewmvmzmziymiwubuhuhomumwchcpcpuacqwknkxkxaokuwstsfsfgcs
zxbabobonrbdxjgjwjwtfjhxrmrereztrlxzszmzmfhzpxhyhuhulvhtxpepcpcrjpbxfqfsfsdlffxnwnanajzn
jxvcvivipnvnxdidqdqvbdrxlolylybplvxtutgtghdtaycbcpcposceykhkxkxugkiysnsfsfausmyatanangia
qyizivivmwiuyqfqdqdskqcygrgtgtemggyoxobobkaokywdwjwjqowoyejererwcesympmzmzcqmwyuvuhuhieu
bzdcdqdqptdfzlilylyvhljztotgtgbvtnzbubobohjbrzjajwjwnxjvzrgreretlrdzhshuhufnhhzpypcpclbp
lzxexkxkrpxpzfkfsfsxdftznqnanadrnxzvwvivijfvcaedererquegamjmzmzwimkaupuhuhcwuoacvcpcpikc
sakbkxkxoykwashsfsfumseaitivivgoiiaqzqdqdmcqmayfylylsqyqaglgtgtyeguaorobobesoyawxwjwjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: caedererque
Cipher: pnrqreredhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: caedererque
Cipher: 3111514151245124145451

Extended Methods:
Method #1

Plaintext: caedererque
method variations:
hfkikwkwvzknlpopbpbaepsqutugugfkuxvzyzmzmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c a e d e r e r q u e 
3 1 5 4 5 2 5 2 1 5 5 
1 1 1 1 1 4 1 4 4 4 1 
They are then read out in rows:
3154525215511111414441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: caedererque
Cipher: cukkveaadtd

Read more ...
Method #3

Plaintext: caedererque
method variations:
avqvfyfdyyl vqvfyfdyyla qvfyfdyylav
vfyfdyylavq fyfdyylavqv yfdyylavqvf
fdyylavqvfy dyylavqvfyf yylavqvfyfd
ylavqvfyfdy lavqvfyfdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: caedererque

first 5040 cipher variations(39615626 total)
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer
caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru
caedeereuqr caedeereurq caedeereruq caedeererqu caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ
caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq
caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu caedeeqrrue caedeeqrreu
caedeeqrure caedeeqruer caedeeqreur caedeeqreru caedeeqrrue caedeeqrreu caedeeqrure caedeeqruer caedeeqreur caedeeqreru
caedeequrre caedeequrer caedeequrre caedeequrer caedeequerr caedeequerr caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr
caedeeqerur caedeeqerru caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr caedeeuqrre caedeeuqrer
caedeeuqrre caedeeuqrer caedeeuqerr caedeeuqerr caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr
caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq
caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr
caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqeurre caedeqeurer caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru
caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqrreue caedeqrreeu caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqruree caedeqruree caedeqruere caedeqrueer
caedeqrueer caedeqruere caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru caedeqrreue caedeqrreeu
caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqruere caedeqrueer caedeqruree caedeqruree caedeqruere caedeqrueer caedeqreeur caedeqreeru caedeqreuer caedeqreure
caedeqrerue caedeqrereu caedequrree caedequrree caedequrere caedequreer caedequreer caedequrere caedequrree caedequrree
caedequrere caedequreer caedequreer caedequrere caedequerre caedequerer caedequerre caedequerer caedequeerr caedequeerr
caedequerer caedequerre caedequeerr caedequeerr caedequerer caedequerre caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqeurre caedeqeurer
caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru
caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer
caedeueqerr caedeueqerr caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr
caedeueerqr caedeueerrq caedeueerrq caedeueerqr caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeurqere caedeurqeer caedeurqree caedeurqree caedeurqere caedeurqeer caedeurrqee caedeurrqee caedeurreqe caedeurreeq
caedeurreeq caedeurreqe caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr caedeuqrere caedeuqreer
caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqerre caedeuqerer caedeuqerre caedeuqerer caedeuqeerr caedeuqeerr
caedeuqrere caedeuqreer caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqeerr caedeuqeerr caedeuqerer caedeuqerre
caedeuqerre caedeuqerer caedeurrqee caedeurrqee caedeurreqe caedeurreeq caedeurreeq caedeurreqe caedeurqree caedeurqree
caedeurqere caedeurqeer caedeurqeer caedeurqere caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeureqer caedeureqre caedeureeqr caedeureerq caedeurereq caedeurerqe caedeuerqre caedeuerqer caedeuerrqe caedeuerreq
caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer caedeueqerr caedeueqerr caedeuerqre caedeuerqer
caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr caedeueerqr caedeueerrq caedeueerrq caedeueerqr
caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr
caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru
caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu
caedeerqeur caedeerqeru caedeerquer caedeerqure caedeerqrue caedeerqreu caedeeruqer caedeeruqre caedeerueqr caedeeruerq
caedeerureq caedeerurqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeeqreur caedeeqreru
caedeeqruer caedeeqrure caedeeqrrue caedeeqrreu caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr caedeeqerur caedeeqerru
caedeequerr caedeequerr caedeequrer caedeequrre caedeequrre caedeequrer caedeeqreur caedeeqreru caedeeqruer caedeeqrure
caedeeqrrue caedeeqrreu caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeeuqrer caedeeuqrre
caedeeuqerr caedeeuqerr caedeeuqrer caedeeuqrre caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr
caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq
caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer
caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu
caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer
caedreeqeur caedreeqeru caedreeuqre caedreeuqer caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru
caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ
caedrerqeue caedrerqeeu caedrerquee caedrerquee caedrerqeue caedrerqeeu caedreruqee caedreruqee caedrerueqe caedrerueeq
caedrerueeq caedrerueqe caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ caedreqreue caedreqreeu
caedreqruee caedreqruee caedreqreue caedreqreeu caedreqerue caedreqereu caedreqeure caedreqeuer caedreqeeur caedreqeeru
caedrequere caedrequeer caedrequree caedrequree caedrequere caedrequeer caedreqeeur caedreqeeru caedreqeuer caedreqeure
caedreqerue caedreqereu caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe caedreuqree caedreuqree
caedreuqere caedreuqeer caedreuqeer caedreuqere caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr
caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe caedreerque caedreerqeu caedreeruqe caedreerueq
caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer caedreeqeur caedreeqeru caedreeuqre caedreeuqer
caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu
caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer
caedreeqeur caedreeqeru caedreeuqre caedreeuqer caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru
caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ
caedrerqeue caedrerqeeu caedrerquee caedrerquee caedrerqeue caedrerqeeu caedreruqee caedreruqee caedrerueqe caedrerueeq
caedrerueeq caedrerueqe caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ caedreqreue caedreqreeu
caedreqruee caedreqruee caedreqreue caedreqreeu caedreqerue caedreqereu caedreqeure caedreqeuer caedreqeeur caedreqeeru
caedrequere caedrequeer caedrequree caedrequree caedrequere caedrequeer caedreqeeur caedreqeeru caedreqeuer caedreqeure
caedreqerue caedreqereu caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe caedreuqree caedreuqree
caedreuqere caedreuqeer caedreuqeer caedreuqere caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr
caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe caedreerque caedreerqeu caedreeruqe caedreerueq
caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer caedreeqeur caedreeqeru caedreeuqre caedreeuqer
caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu
caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrreqeue caedrreqeeu caedrrequee caedrrequee
caedrreqeue caedrreqeeu caedrreuqee caedrreuqee caedrreueqe caedrreueeq caedrreueeq caedrreueqe caedrreeque caedrreeqeu
caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ
caedrreqeue caedrreqeeu caedrrequee caedrrequee caedrreqeue caedrreqeeu caedrreuqee caedrreuqee caedrreueqe caedrreueeq
caedrreueeq caedrreueqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrrqeeue caedrrqeeeu
caedrrqeuee caedrrqeuee caedrrqeeue caedrrqeeeu caedrrqeeue caedrrqeeeu caedrrqeuee caedrrqeuee caedrrqeeue caedrrqeeeu
caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqeeue caedrrqeeeu caedrrqeuee caedrrqeuee
caedrrqeeue caedrrqeeeu caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe caedrruqeee caedrruqeee
caedrruqeee caedrruqeee caedrruqeee caedrruqeee caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe
caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq
caedrreeeuq caedrreeequ caedrreqeue caedrreqeeu caedrrequee caedrrequee caedrreqeue caedrreqeeu caedrreuqee caedrreuqee
caedrreueqe caedrreueeq caedrreueeq caedrreueqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ
caedrqereue caedrqereeu caedrqeruee caedrqeruee caedrqereue caedrqereeu caedrqeerue caedrqeereu caedrqeeure caedrqeeuer
caedrqeeeur caedrqeeeru caedrqeuere caedrqeueer caedrqeuree caedrqeuree caedrqeuere caedrqeueer caedrqeeeur caedrqeeeru
caedrqeeuer caedrqeeure caedrqeerue caedrqeereu caedrqreeue caedrqreeeu caedrqreuee caedrqreuee caedrqreeue caedrqreeeu
caedrqreeue caedrqreeeu caedrqreuee caedrqreuee caedrqreeue caedrqreeeu caedrqrueee caedrqrueee caedrqrueee caedrqrueee
caedrqrueee caedrqrueee caedrqreeue caedrqreeeu caedrqreuee caedrqreuee caedrqreeue caedrqreeeu caedrqereue caedrqereeu
caedrqeruee caedrqeruee caedrqereue caedrqereeu caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru
caedrqeuere caedrqeueer caedrqeuree caedrqeuree caedrqeuere caedrqeueer caedrqeeeur caedrqeeeru caedrqeeuer caedrqeeure
caedrqeerue caedrqeereu caedrqureee caedrqureee caedrqureee caedrqureee caedrqureee caedrqureee caedrqueree caedrqueree
caedrqueere caedrqueeer caedrqueeer caedrqueere caedrqueere caedrqueeer caedrqueree caedrqueree caedrqueere caedrqueeer
caedrqueeer caedrqueere caedrqueeer caedrqueere caedrqueree caedrqueree caedrqereue caedrqereeu caedrqeruee caedrqeruee
caedrqereue caedrqereeu caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru caedrqeuere caedrqeueer
caedrqeuree caedrqeuree caedrqeuere caedrqeueer caedrqeeeur caedrqeeeru caedrqeeuer caedrqeeure caedrqeerue caedrqeereu
caedruerqee caedruerqee caedruereqe caedruereeq caedruereeq caedruereqe caedrueqree caedrueqree caedrueqere caedrueqeer
caedrueqeer caedrueqere caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr caedrueeqer caedrueeqre
caedrueeeqr caedrueeerq caedrueereq caedrueerqe caedrureqee caedrureqee caedrureeqe caedrureeeq caedrureeeq caedrureeqe
caedrurqeee caedrurqeee caedrurqeee caedrurqeee caedrurqeee caedrurqeee caedrureqee caedrureqee caedrureeqe caedrureeeq
caedrureeeq caedrureeqe caedrureqee caedrureqee caedrureeqe caedrureeeq caedrureeeq caedrureeqe caedruqreee caedruqreee
caedruqreee caedruqreee caedruqreee caedruqreee caedruqeree caedruqeree caedruqeere caedruqeeer caedruqeeer caedruqeere
caedruqeere caedruqeeer caedruqeree caedruqeree caedruqeere caedruqeeer caedruqeeer caedruqeere caedruqeeer caedruqeere
caedruqeree caedruqeree caedruerqee caedruerqee caedruereqe caedruereeq caedruereeq caedruereqe caedrueqree caedrueqree
caedrueqere caedrueqeer caedrueqeer caedrueqere caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr
caedrueeqer caedrueeqre caedrueeeqr caedrueeerq caedrueereq caedrueerqe caedruerqee caedruerqee caedruereqe caedruereeq
caedruereeq caedruereqe caedrueqree caedrueqree caedrueqere caedrueqeer caedrueqeer caedrueqere caedrueeqre caedrueeqer
caedrueerqe caedrueereq caedrueeerq caedrueeeqr caedrueeqer caedrueeqre caedrueeeqr caedrueeerq caedrueereq caedrueerqe
caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer
caedreeqeur caedreeqeru caedreeuqre caedreeuqer caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru
caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ
caedrerqeue caedrerqeeu caedrerquee caedrerquee caedrerqeue caedrerqeeu caedreruqee caedreruqee caedrerueqe caedrerueeq
caedrerueeq caedrerueqe caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ caedreqreue caedreqreeu
caedreqruee caedreqruee caedreqreue caedreqreeu caedreqerue caedreqereu caedreqeure caedreqeuer caedreqeeur caedreqeeru
caedrequere caedrequeer caedrequree caedrequree caedrequere caedrequeer caedreqeeur caedreqeeru caedreqeuer caedreqeure
caedreqerue caedreqereu caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe caedreuqree caedreuqree
caedreuqere caedreuqeer caedreuqeer caedreuqere caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr
caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe caedreerque caedreerqeu caedreeruqe caedreerueq
caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer caedreeqeur caedreeqeru caedreeuqre caedreeuqer
caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer
caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru
caedeereuqr caedeereurq caedeereruq caedeererqu caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ
caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq
caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu caedeeqrrue caedeeqrreu
caedeeqrure caedeeqruer caedeeqreur caedeeqreru caedeeqrrue caedeeqrreu caedeeqrure caedeeqruer caedeeqreur caedeeqreru
caedeequrre caedeequrer caedeequrre caedeequrer caedeequerr caedeequerr caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr
caedeeqerur caedeeqerru caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr caedeeuqrre caedeeuqrer
caedeeuqrre caedeeuqrer caedeeuqerr caedeeuqerr caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr
caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq
caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr
caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqeurre caedeqeurer caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru
caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqrreue caedeqrreeu caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqruree caedeqruree caedeqruere caedeqrueer
caedeqrueer caedeqruere caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru caedeqrreue caedeqrreeu
caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqruere caedeqrueer caedeqruree caedeqruree caedeqruere caedeqrueer caedeqreeur caedeqreeru caedeqreuer caedeqreure
caedeqrerue caedeqrereu caedequrree caedequrree caedequrere caedequreer caedequreer caedequrere caedequrree caedequrree
caedequrere caedequreer caedequreer caedequrere caedequerre caedequerer caedequerre caedequerer caedequeerr caedequeerr
caedequerer caedequerre caedequeerr caedequeerr caedequerer caedequerre caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqeurre caedeqeurer
caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru
caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer
caedeueqerr caedeueqerr caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr
caedeueerqr caedeueerrq caedeueerrq caedeueerqr caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeurqere caedeurqeer caedeurqree caedeurqree caedeurqere caedeurqeer caedeurrqee caedeurrqee caedeurreqe caedeurreeq
caedeurreeq caedeurreqe caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr caedeuqrere caedeuqreer
caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqerre caedeuqerer caedeuqerre caedeuqerer caedeuqeerr caedeuqeerr
caedeuqrere caedeuqreer caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqeerr caedeuqeerr caedeuqerer caedeuqerre
caedeuqerre caedeuqerer caedeurrqee caedeurrqee caedeurreqe caedeurreeq caedeurreeq caedeurreqe caedeurqree caedeurqree
caedeurqere caedeurqeer caedeurqeer caedeurqere caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeureqer caedeureqre caedeureeqr caedeureerq caedeurereq caedeurerqe caedeuerqre caedeuerqer caedeuerrqe caedeuerreq
caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer caedeueqerr caedeueqerr caedeuerqre caedeuerqer
caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr caedeueerqr caedeueerrq caedeueerrq caedeueerqr
caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr
caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru
caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu
caedeerqeur caedeerqeru caedeerquer caedeerqure caedeerqrue caedeerqreu caedeeruqer caedeeruqre caedeerueqr caedeeruerq
caedeerureq caedeerurqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeeqreur caedeeqreru
caedeeqruer caedeeqrure caedeeqrrue caedeeqrreu caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr caedeeqerur caedeeqerru
caedeequerr caedeequerr caedeequrer caedeequrre caedeequrre caedeequrer caedeeqreur caedeeqreru caedeeqruer caedeeqrure
caedeeqrrue caedeeqrreu caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeeuqrer caedeeuqrre
caedeeuqerr caedeeuqerr caedeeuqrer caedeeuqrre caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr
caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq
caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer
caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu
caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrreqeue caedrreqeeu caedrrequee caedrrequee
caedrreqeue caedrreqeeu caedrreuqee caedrreuqee caedrreueqe caedrreueeq caedrreueeq caedrreueqe caedrreeque caedrreeqeu
caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ
caedrreqeue caedrreqeeu caedrrequee caedrrequee caedrreqeue caedrreqeeu caedrreuqee caedrreuqee caedrreueqe caedrreueeq
caedrreueeq caedrreueqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ caedrrqeeue caedrrqeeeu
caedrrqeuee caedrrqeuee caedrrqeeue caedrrqeeeu caedrrqeeue caedrrqeeeu caedrrqeuee caedrrqeuee caedrrqeeue caedrrqeeeu
caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqueee caedrrqeeue caedrrqeeeu caedrrqeuee caedrrqeuee
caedrrqeeue caedrrqeeeu caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe caedrruqeee caedrruqeee
caedrruqeee caedrruqeee caedrruqeee caedrruqeee caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe
caedrrueqee caedrrueqee caedrrueeqe caedrrueeeq caedrrueeeq caedrrueeqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq
caedrreeeuq caedrreeequ caedrreqeue caedrreqeeu caedrrequee caedrrequee caedrreqeue caedrreqeeu caedrreuqee caedrreuqee
caedrreueqe caedrreueeq caedrreueeq caedrreueqe caedrreeque caedrreeqeu caedrreeuqe caedrreeueq caedrreeeuq caedrreeequ
caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ caedrerqeue caedrerqeeu caedrerquee caedrerquee
caedrerqeue caedrerqeeu caedreruqee caedreruqee caedrerueqe caedrerueeq caedrerueeq caedrerueqe caedrereque caedrereqeu
caedrereuqe caedrereueq caedrereeuq caedrereequ caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ
caedreeqrue caedreeqreu caedreequre caedreequer caedreeqeur caedreeqeru caedreeuqre caedreeuqer caedreeurqe caedreeureq
caedreeuerq caedreeueqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedreqerue caedreqereu
caedreqeure caedreqeuer caedreqeeur caedreqeeru caedreqreue caedreqreeu caedreqruee caedreqruee caedreqreue caedreqreeu
caedrequree caedrequree caedrequere caedrequeer caedrequeer caedrequere caedreqerue caedreqereu caedreqeure caedreqeuer
caedreqeeur caedreqeeru caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr caedreuqere caedreuqeer
caedreuqree caedreuqree caedreuqere caedreuqeer caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe
caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq
caedreeeruq caedreeerqu caedreeqeur caedreeqeru caedreequer caedreequre caedreeqrue caedreeqreu caedreeuqer caedreeuqre
caedreeueqr caedreeuerq caedreeureq caedreeurqe caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ
caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer
caedreeqeur caedreeqeru caedreeuqre caedreeuqer caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru
caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ
caedrerqeue caedrerqeeu caedrerquee caedrerquee caedrerqeue caedrerqeeu caedreruqee caedreruqee caedrerueqe caedrerueeq
caedrerueeq caedrerueqe caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ caedreqreue caedreqreeu
caedreqruee caedreqruee caedreqreue caedreqreeu caedreqerue caedreqereu caedreqeure caedreqeuer caedreqeeur caedreqeeru
caedrequere caedrequeer caedrequree caedrequree caedrequere caedrequeer caedreqeeur caedreqeeru caedreqeuer caedreqeure
caedreqerue caedreqereu caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe caedreuqree caedreuqree
caedreuqere caedreuqeer caedreuqeer caedreuqere caedreueqre caedreueqer caedreuerqe caedreuereq caedreueerq caedreueeqr
caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe caedreerque caedreerqeu caedreeruqe caedreerueq
caedreereuq caedreerequ caedreeqrue caedreeqreu caedreequre caedreequer caedreeqeur caedreeqeru caedreeuqre caedreeuqer
caedreeurqe caedreeureq caedreeuerq caedreeueqr caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu
caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru caedrqereue caedrqereeu caedrqeruee caedrqeruee
caedrqereue caedrqereeu caedrqeuree caedrqeuree caedrqeuere caedrqeueer caedrqeueer caedrqeuere caedrqeerue caedrqeereu
caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru
caedrqereue caedrqereeu caedrqeruee caedrqeruee caedrqereue caedrqereeu caedrqeuree caedrqeuree caedrqeuere caedrqeueer
caedrqeueer caedrqeuere caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru caedrqreeue caedrqreeeu
caedrqreuee caedrqreuee caedrqreeue caedrqreeeu caedrqreeue caedrqreeeu caedrqreuee caedrqreuee caedrqreeue caedrqreeeu
caedrqrueee caedrqrueee caedrqrueee caedrqrueee caedrqrueee caedrqrueee caedrqreeue caedrqreeeu caedrqreuee caedrqreuee
caedrqreeue caedrqreeeu caedrqueree caedrqueree caedrqueere caedrqueeer caedrqueeer caedrqueere caedrqureee caedrqureee
caedrqureee caedrqureee caedrqureee caedrqureee caedrqueree caedrqueree caedrqueere caedrqueeer caedrqueeer caedrqueere
caedrqueree caedrqueree caedrqueere caedrqueeer caedrqueeer caedrqueere caedrqeerue caedrqeereu caedrqeeure caedrqeeuer
caedrqeeeur caedrqeeeru caedrqereue caedrqereeu caedrqeruee caedrqeruee caedrqereue caedrqereeu caedrqeuree caedrqeuree
caedrqeuere caedrqeueer caedrqeueer caedrqeuere caedrqeerue caedrqeereu caedrqeeure caedrqeeuer caedrqeeeur caedrqeeeru
caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr caedrueqere caedrueqeer caedrueqree caedrueqree
caedrueqere caedrueqeer caedruerqee caedruerqee caedruereqe caedruereeq caedruereeq caedruereqe caedrueeqre caedrueeqer
caedrueerqe caedrueereq caedrueeerq caedrueeeqr caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr
caedrueqere caedrueqeer caedrueqree caedrueqree caedrueqere caedrueqeer caedruerqee caedruerqee caedruereqe caedruereeq
caedruereeq caedruereqe caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr caedruqeere caedruqeeer
caedruqeree caedruqeree caedruqeere caedruqeeer caedruqeere caedruqeeer caedruqeree caedruqeree caedruqeere caedruqeeer
caedruqreee caedruqreee caedruqreee caedruqreee caedruqreee caedruqreee caedruqeere caedruqeeer caedruqeree caedruqeree
caedruqeere caedruqeeer caedrureqee caedrureqee caedrureeqe caedrureeeq caedrureeeq caedrureeqe caedrurqeee caedrurqeee
caedrurqeee caedrurqeee caedrurqeee caedrurqeee caedrureqee caedrureqee caedrureeqe caedrureeeq caedrureeeq caedrureeqe
caedrureqee caedrureqee caedrureeqe caedrureeeq caedrureeeq caedrureeqe caedrueeqre caedrueeqer caedrueerqe caedrueereq
caedrueeerq caedrueeeqr caedrueqere caedrueqeer caedrueqree caedrueqree caedrueqere caedrueqeer caedruerqee caedruerqee
caedruereqe caedruereeq caedruereeq caedruereqe caedrueeqre caedrueeqer caedrueerqe caedrueereq caedrueeerq caedrueeeqr
caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu caedreeqeur caedreeqeru caedreequer caedreequre
caedreeqrue caedreeqreu caedreeuqer caedreeuqre caedreeueqr caedreeuerq caedreeureq caedreeurqe caedreerque caedreerqeu
caedreeruqe caedreerueq caedreereuq caedreerequ caedreeequr caedreeeqru caedreeeuqr caedreeeurq caedreeeruq caedreeerqu
caedreeqeur caedreeqeru caedreequer caedreequre caedreeqrue caedreeqreu caedreeuqer caedreeuqre caedreeueqr caedreeuerq
caedreeureq caedreeurqe caedreerque caedreerqeu caedreeruqe caedreerueq caedreereuq caedreerequ caedreqeeur caedreqeeru
caedreqeuer caedreqeure caedreqerue caedreqereu caedreqeeur caedreqeeru caedreqeuer caedreqeure caedreqerue caedreqereu
caedrequeer caedrequere caedrequeer caedrequere caedrequree caedrequree caedreqreue caedreqreeu caedreqruee caedreqruee
caedreqreue caedreqreeu caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe caedreuqeer caedreuqere
caedreuqeer caedreuqere caedreuqree caedreuqree caedreueqer caedreueqre caedreueeqr caedreueerq caedreuereq caedreuerqe
caedreurqee caedreurqee caedreureqe caedreureeq caedreureeq caedreureqe caedrereque caedrereqeu caedrereuqe caedrereueq
caedrereeuq caedrereequ caedrerqeue caedrerqeeu caedrerquee caedrerquee caedrerqeue caedrerqeeu caedreruqee caedreruqee
caedrerueqe caedrerueeq caedrerueeq caedrerueqe caedrereque caedrereqeu caedrereuqe caedrereueq caedrereeuq caedrereequ
caedqrereue caedqrereeu caedqreruee caedqreruee caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer
caedqreeeur caedqreeeru caedqreuere caedqreueer caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru
caedqreeuer caedqreeure caedqreerue caedqreereu caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu
caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu caedqrrueee caedqrrueee caedqrrueee caedqrrueee
caedqrrueee caedqrrueee caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu caedqrereue caedqrereeu
caedqreruee caedqreruee caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer caedqreeeur caedqreeeru
caedqreuere caedqreueer caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru caedqreeuer caedqreeure
caedqreerue caedqreereu caedqrureee caedqrureee caedqrureee caedqrureee caedqrureee caedqrureee caedqrueree caedqrueree
caedqrueere caedqrueeer caedqrueeer caedqrueere caedqrueere caedqrueeer caedqrueree caedqrueree caedqrueere caedqrueeer
caedqrueeer caedqrueere caedqrueeer caedqrueere caedqrueree caedqrueree caedqrereue caedqrereeu caedqreruee caedqreruee
caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer caedqreeeur caedqreeeru caedqreuere caedqreueer
caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru caedqreeuer caedqreeure caedqreerue caedqreereu
caedqerreue caedqerreeu caedqerruee caedqerruee caedqerreue caedqerreeu caedqererue caedqerereu caedqereure caedqereuer
caedqereeur caedqereeru caedqeruere caedqerueer caedqeruree caedqeruree caedqeruere caedqerueer caedqereeur caedqereeru
caedqereuer caedqereure caedqererue caedqerereu caedqerreue caedqerreeu caedqerruee caedqerruee caedqerreue caedqerreeu
caedqererue caedqerereu caedqereure caedqereuer caedqereeur caedqereeru caedqeruere caedqerueer caedqeruree caedqeruree
caedqeruere caedqerueer caedqereeur caedqereeru caedqereuer caedqereure caedqererue caedqerereu caedqeerrue caedqeerreu
caedqeerure caedqeeruer caedqeereur caedqeereru caedqeerrue caedqeerreu caedqeerure caedqeeruer caedqeereur caedqeereru
caedqeeurre caedqeeurer caedqeeurre caedqeeurer caedqeeuerr caedqeeuerr caedqeeerur caedqeeerru caedqeeeurr caedqeeeurr
caedqeeerur caedqeeerru caedqeurere caedqeureer caedqeurree caedqeurree caedqeurere caedqeureer caedqeuerre caedqeuerer
caedqeuerre caedqeuerer caedqeueerr caedqeueerr caedqeurere caedqeureer caedqeurree caedqeurree caedqeurere caedqeureer
caedqeueerr caedqeueerr caedqeuerer caedqeuerre caedqeuerre caedqeuerer caedqeereur caedqeereru caedqeeruer caedqeerure
caedqeerrue caedqeerreu caedqeeerur caedqeeerru caedqeeeurr caedqeeeurr caedqeeerur caedqeeerru caedqeeuerr caedqeeuerr
caedqeeurer caedqeeurre caedqeeurre caedqeeurer caedqeereur caedqeereru caedqeeruer caedqeerure caedqeerrue caedqeerreu
caedqrereue caedqrereeu caedqreruee caedqreruee caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer
caedqreeeur caedqreeeru caedqreuere caedqreueer caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru
caedqreeuer caedqreeure caedqreerue caedqreereu caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu
caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu caedqrrueee caedqrrueee caedqrrueee caedqrrueee
caedqrrueee caedqrrueee caedqrreeue caedqrreeeu caedqrreuee caedqrreuee caedqrreeue caedqrreeeu caedqrereue caedqrereeu
caedqreruee caedqreruee caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer caedqreeeur caedqreeeru
caedqreuere caedqreueer caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru caedqreeuer caedqreeure
caedqreerue caedqreereu caedqrureee caedqrureee caedqrureee caedqrureee caedqrureee caedqrureee caedqrueree caedqrueree
caedqrueere caedqrueeer caedqrueeer caedqrueere caedqrueere caedqrueeer caedqrueree caedqrueree caedqrueere caedqrueeer
caedqrueeer caedqrueere caedqrueeer caedqrueere caedqrueree caedqrueree caedqrereue caedqrereeu caedqreruee caedqreruee
caedqrereue caedqrereeu caedqreerue caedqreereu caedqreeure caedqreeuer caedqreeeur caedqreeeru caedqreuere caedqreueer
caedqreuree caedqreuree caedqreuere caedqreueer caedqreeeur caedqreeeru caedqreeuer caedqreeure caedqreerue caedqreereu
caedqeerrue caedqeerreu caedqeerure caedqeeruer caedqeereur caedqeereru caedqeerrue caedqeerreu caedqeerure caedqeeruer
caedqeereur caedqeereru caedqeeurre caedqeeurer caedqeeurre caedqeeurer caedqeeuerr caedqeeuerr caedqeeerur caedqeeerru
caedqeeeurr caedqeeeurr caedqeeerur caedqeeerru caedqererue caedqerereu caedqereure caedqereuer caedqereeur caedqereeru
caedqerreue caedqerreeu caedqerruee caedqerruee caedqerreue caedqerreeu caedqeruree caedqeruree caedqeruere caedqerueer
caedqerueer caedqeruere caedqererue caedqerereu caedqereure caedqereuer caedqereeur caedqereeru caedqerreue caedqerreeu
caedqerruee caedqerruee caedqerreue caedqerreeu caedqererue caedqerereu caedqereure caedqereuer caedqereeur caedqereeru
caedqeruere caedqerueer caedqeruree caedqeruree caedqeruere caedqerueer caedqereeur caedqereeru caedqereuer caedqereure
caedqererue caedqerereu caedqeurree caedqeurree caedqeurere caedqeureer caedqeureer caedqeurere caedqeurree caedqeurree
caedqeurere caedqeureer caedqeureer caedqeurere caedqeuerre caedqeuerer caedqeuerre caedqeuerer caedqeueerr caedqeueerr
caedqeuerer caedqeuerre caedqeueerr caedqeueerr caedqeuerer caedqeuerre caedqeerrue caedqeerreu caedqeerure caedqeeruer
caedqeereur caedqeereru caedqeerrue caedqeerreu caedqeerure caedqeeruer caedqeereur caedqeereru caedqeeurre caedqeeurer
caedqeeurre caedqeeurer caedqeeuerr caedqeeuerr caedqeeerur caedqeeerru caedqeeeurr caedqeeeurr caedqeeerur caedqeeerru
caedquerere caedquereer caedquerree caedquerree caedquerere caedquereer caedqueerre caedqueerer caedqueerre caedqueerer
caedqueeerr caedqueeerr caedquerere caedquereer caedquerree caedquerree caedquerere caedquereer caedqueeerr caedqueeerr
caedqueerer caedqueerre caedqueerre caedqueerer caedqureere caedqureeer caedqureree caedqureree caedqureere caedqureeer
caedqureere caedqureeer caedqureree caedqureree caedqureere caedqureeer caedqurreee caedqurreee caedqurreee caedqurreee
caedqurreee caedqurreee caedqureere caedqureeer caedqureree caedqureree caedqureere caedqureeer caedquerere caedquereer
caedquerree caedquerree caedquerere caedquereer caedqueerre caedqueerer caedqueerre caedqueerer caedqueeerr caedqueeerr
caedquerere caedquereer caedquerree caedquerree caedquerere caedquereer caedqueeerr caedqueeerr caedqueerer caedqueerre
caedqueerre caedqueerer caedqurreee caedqurreee caedqurreee caedqurreee caedqurreee caedqurreee caedqureree caedqureree
caedqureere caedqureeer caedqureeer caedqureere caedqureere caedqureeer caedqureree caedqureree caedqureere caedqureeer
caedqureeer caedqureere caedqureeer caedqureere caedqureree caedqureree caedquerere caedquereer caedquerree caedquerree
caedquerere caedquereer caedqueerre caedqueerer caedqueerre caedqueerer caedqueeerr caedqueeerr caedquerere caedquereer
caedquerree caedquerree caedquerere caedquereer caedqueeerr caedqueeerr caedqueerer caedqueerre caedqueerre caedqueerer
caedqeereur caedqeereru caedqeeruer caedqeerure caedqeerrue caedqeerreu caedqeeerur caedqeeerru caedqeeeurr caedqeeeurr
caedqeeerur caedqeeerru caedqeeuerr caedqeeuerr caedqeeurer caedqeeurre caedqeeurre caedqeeurer caedqeereur caedqeereru
caedqeeruer caedqeerure caedqeerrue caedqeerreu caedqereeur caedqereeru caedqereuer caedqereure caedqererue caedqerereu
caedqereeur caedqereeru caedqereuer caedqereure caedqererue caedqerereu caedqerueer caedqeruere caedqerueer caedqeruere
caedqeruree caedqeruree caedqerreue caedqerreeu caedqerruee caedqerruee caedqerreue caedqerreeu caedqeereur caedqeereru
caedqeeruer caedqeerure caedqeerrue caedqeerreu caedqeeerur caedqeeerru caedqeeeurr caedqeeeurr caedqeeerur caedqeeerru
caedqeeuerr caedqeeuerr caedqeeurer caedqeeurre caedqeeurre caedqeeurer caedqeereur caedqeereru caedqeeruer caedqeerure
caedqeerrue caedqeerreu caedqeureer caedqeurere caedqeureer caedqeurere caedqeurree caedqeurree caedqeuerer caedqeuerre
caedqeueerr caedqeueerr caedqeuerer caedqeuerre caedqeueerr caedqeueerr caedqeuerer caedqeuerre caedqeuerre caedqeuerer
caedqeureer caedqeurere caedqeureer caedqeurere caedqeurree caedqeurree caedqerreue caedqerreeu caedqerruee caedqerruee
caedqerreue caedqerreeu caedqererue caedqerereu caedqereure caedqereuer caedqereeur caedqereeru caedqeruere caedqerueer
caedqeruree caedqeruree caedqeruere caedqerueer caedqereeur caedqereeru caedqereuer caedqereure caedqererue caedqerereu
caedurerqee caedurerqee caedurereqe caedurereeq caedurereeq caedurereqe caedureqree caedureqree caedureqere caedureqeer
caedureqeer caedureqere caedureeqre caedureeqer caedureerqe caedureereq caedureeerq caedureeeqr caedureeqer caedureeqre
caedureeeqr caedureeerq caedureereq caedureerqe caedurreqee caedurreqee caedurreeqe caedurreeeq caedurreeeq caedurreeqe
caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurreqee caedurreqee caedurreeqe caedurreeeq
caedurreeeq caedurreeqe caedurreqee caedurreqee caedurreeqe caedurreeeq caedurreeeq caedurreeqe caedurqreee caedurqreee
caedurqreee caedurqreee caedurqreee caedurqreee caedurqeree caedurqeree caedurqeere caedurqeeer caedurqeeer caedurqeere
caedurqeere caedurqeeer caedurqeree caedurqeree caedurqeere caedurqeeer caedurqeeer caedurqeere caedurqeeer caedurqeere
caedurqeree caedurqeree caedurerqee caedurerqee caedurereqe caedurereeq caedurereeq caedurereqe caedureqree caedureqree
caedureqere caedureqeer caedureqeer caedureqere caedureeqre caedureeqer caedureerqe caedureereq caedureeerq caedureeeqr
caedureeqer caedureeqre caedureeeqr caedureeerq caedureereq caedureerqe caedurerqee caedurerqee caedurereqe caedurereeq
caedurereeq caedurereqe caedureqree caedureqree caedureqere caedureqeer caedureqeer caedureqere caedureeqre caedureeqer
caedureerqe caedureereq caedureeerq caedureeeqr caedureeqer caedureeqre caedureeeqr caedureeerq caedureereq caedureerqe
caeduerrqee caeduerrqee caeduerreqe caeduerreeq caeduerreeq caeduerreqe caeduerqree caeduerqree caeduerqere caeduerqeer
caeduerqeer caeduerqere caeduereqre caeduereqer caeduererqe caeduerereq caeduereerq caeduereeqr caeduereqer caeduereqre
caeduereeqr caeduereerq caeduerereq caeduererqe caeduerrqee caeduerrqee caeduerreqe caeduerreeq caeduerreeq caeduerreqe
caeduerqree caeduerqree caeduerqere caeduerqeer caeduerqeer caeduerqere caeduereqre caeduereqer caeduererqe caeduerereq
caeduereerq caeduereeqr caeduereqer caeduereqre caeduereeqr caeduereerq caeduerereq caeduererqe caedueqrree caedueqrree
caedueqrere caedueqreer caedueqreer caedueqrere caedueqrree caedueqrree caedueqrere caedueqreer caedueqreer caedueqrere
caedueqerre caedueqerer caedueqerre caedueqerer caedueqeerr caedueqeerr caedueqerer caedueqerre caedueqeerr caedueqeerr
caedueqerer caedueqerre caedueerqre caedueerqer caedueerrqe caedueerreq caedueererq caedueereqr caedueeqrre caedueeqrer
caedueeqrre caedueeqrer caedueeqerr caedueeqerr caedueerqre caedueerqer caedueerrqe caedueerreq caedueererq caedueereqr
caedueeeqrr caedueeeqrr caedueeerqr caedueeerrq caedueeerrq caedueeerqr caedueerqer caedueerqre caedueereqr caedueererq
caedueerreq caedueerrqe caedueeqrer caedueeqrre caedueeqerr caedueeqerr caedueeqrer caedueeqrre caedueeeqrr caedueeeqrr
caedueeerqr caedueeerrq caedueeerrq caedueeerqr caedueerqer caedueerqre caedueereqr caedueererq caedueerreq caedueerrqe
caedurerqee caedurerqee caedurereqe caedurereeq caedurereeq caedurereqe caedureqree caedureqree caedureqere caedureqeer
caedureqeer caedureqere caedureeqre caedureeqer caedureerqe caedureereq caedureeerq caedureeeqr caedureeqer caedureeqre
caedureeeqr caedureeerq caedureereq caedureerqe caedurreqee caedurreqee caedurreeqe caedurreeeq caedurreeeq caedurreeqe
caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurrqeee caedurreqee caedurreqee caedurreeqe caedurreeeq
caedurreeeq caedurreeqe caedurreqee caedurreqee caedurreeqe caedurreeeq caedurreeeq caedurreeqe caedurqreee caedurqreee
caedurqreee caedurqreee caedurqreee caedurqreee caedurqeree caedurqeree caedurqeere caedurqeeer caedurqeeer caedurqeere
caedurqeere caedurqeeer caedurqeree caedurqeree caedurqeere caedurqeeer caedurqeeer caedurqeere caedurqeeer caedurqeere
caedurqeree caedurqeree caedurerqee caedurerqee caedurereqe caedurereeq caedurereeq caedurereqe caedureqree caedureqree
caedureqere caedureqeer caedureqeer caedureqere caedureeqre caedureeqer caedureerqe caedureereq caedureeerq caedureeeqr
caedureeqer caedureeqre caedureeeqr caedureeerq caedureereq caedureerqe caedurerqee caedurerqee caedurereqe caedurereeq
caedurereeq caedurereqe caedureqree caedureqree caedureqere caedureqeer caedureqeer caedureqere caedureeqre caedureeqer
caedureerqe caedureereq caedureeerq caedureeeqr caedureeqer caedureeqre caedureeeqr caedureeerq caedureereq caedureerqe
caeduqerree caeduqerree caeduqerere caeduqereer caeduqereer caeduqerere caeduqerree caeduqerree caeduqerere caeduqereer
caeduqereer caeduqerere caeduqeerre caeduqeerer caeduqeerre caeduqeerer caeduqeeerr caeduqeeerr caeduqeerer caeduqeerre
caeduqeeerr caeduqeeerr caeduqeerer caeduqeerre caeduqreree caeduqreree caeduqreere caeduqreeer caeduqreeer caeduqreere
caeduqrreee caeduqrreee caeduqrreee caeduqrreee caeduqrreee caeduqrreee caeduqreree caeduqreree caeduqreere caeduqreeer
caeduqreeer caeduqreere caeduqreree caeduqreree caeduqreere caeduqreeer caeduqreeer caeduqreere caeduqrreee caeduqrreee
caeduqrreee caeduqrreee caeduqrreee caeduqrreee caeduqreree caeduqreree caeduqreere caeduqreeer caeduqreeer caeduqreere
caeduqreere caeduqreeer caeduqreree caeduqreree caeduqreere caeduqreeer caeduqreeer caeduqreere caeduqreeer caeduqreere
caeduqreree caeduqreree caeduqerree caeduqerree caeduqerere caeduqereer caeduqereer caeduqerere caeduqerree caeduqerree
caeduqerere caeduqereer caeduqereer caeduqerere caeduqeerre caeduqeerer caeduqeerre caeduqeerer caeduqeeerr caeduqeeerr
caeduqeerer caeduqeerre caeduqeeerr caeduqeeerr caeduqeerer caeduqeerre caeduqerree caeduqerree caeduqerere caeduqereer
caeduqereer caeduqerere caeduqerree caeduqerree caeduqerere caeduqereer caeduqereer caeduqerere caeduqeerre caeduqeerer
caeduqeerre caeduqeerer caeduqeeerr caeduqeeerr caeduqeerer caeduqeerre caeduqeeerr caeduqeeerr caeduqeerer caeduqeerre
caedueerqre caedueerqer caedueerrqe caedueerreq caedueererq caedueereqr caedueeqrre caedueeqrer caedueeqrre caedueeqrer
caedueeqerr caedueeqerr caedueerqre caedueerqer caedueerrqe caedueerreq caedueererq caedueereqr caedueeeqrr caedueeeqrr
caedueeerqr caedueeerrq caedueeerrq caedueeerqr caeduereqre caeduereqer caeduererqe caeduerereq caeduereerq caeduereeqr
caeduerqere caeduerqeer caeduerqree caeduerqree caeduerqere caeduerqeer caeduerrqee caeduerrqee caeduerreqe caeduerreeq
caeduerreeq caeduerreqe caeduereqre caeduereqer caeduererqe caeduerereq caeduereerq caeduereeqr caedueqrere caedueqreer
caedueqrree caedueqrree caedueqrere caedueqreer caedueqerre caedueqerer caedueqerre caedueqerer caedueqeerr caedueqeerr
caedueqrere caedueqreer caedueqrree caedueqrree caedueqrere caedueqreer caedueqeerr caedueqeerr caedueqerer caedueqerre
caedueqerre caedueqerer caeduerrqee caeduerrqee caeduerreqe caeduerreeq caeduerreeq caeduerreqe caeduerqree caeduerqree
caeduerqere caeduerqeer caeduerqeer caeduerqere caeduereqre caeduereqer caeduererqe caeduerereq caeduereerq caeduereeqr
caeduereqer caeduereqre caeduereeqr caeduereerq caeduerereq caeduererqe caedueerqre caedueerqer caedueerrqe caedueerreq
caedueererq caedueereqr caedueeqrre caedueeqrer caedueeqrre caedueeqrer caedueeqerr caedueeqerr caedueerqre caedueerqer
caedueerrqe caedueerreq caedueererq caedueereqr caedueeeqrr caedueeeqrr caedueeerqr caedueeerrq caedueeerrq caedueeerqr
caedueerqer caedueerqre caedueereqr caedueererq caedueerreq caedueerrqe caedueeqrer caedueeqrre caedueeqerr caedueeqerr
caedueeqrer caedueeqrre caedueeeqrr caedueeeqrr caedueeerqr caedueeerrq caedueeerrq caedueeerqr caedueerqer caedueerqre
caedueereqr caedueererq caedueerreq caedueerrqe caeduereqer caeduereqre caeduereeqr caeduereerq caeduerereq caeduererqe
caeduerqeer caeduerqere caeduerqeer caeduerqere caeduerqree caeduerqree caeduereqer caeduereqre caeduereeqr caeduereerq
caeduerereq caeduererqe caeduerrqee caeduerrqee caeduerreqe caeduerreeq caeduerreeq caeduerreqe caedueqreer caedueqrere
caedueqreer caedueqrere caedueqrree caedueqrree caedueqerer caedueqerre caedueqeerr caedueqeerr caedueqerer caedueqerre
caedueqeerr caedueqeerr caedueqerer caedueqerre caedueqerre caedueqerer caedueqreer caedueqrere caedueqreer caedueqrere
caedueqrree caedueqrree caedueerqer caedueerqre caedueereqr caedueererq caedueerreq caedueerrqe caedueeqrer caedueeqrre
caedueeqerr caedueeqerr caedueeqrer caedueeqrre caedueeeqrr caedueeeqrr caedueeerqr caedueeerrq caedueeerrq caedueeerqr
caedueerqer caedueerqre caedueereqr caedueererq caedueerreq caedueerrqe caeduerrqee caeduerrqee caeduerreqe caeduerreeq
caeduerreeq caeduerreqe caeduerqree caeduerqree caeduerqere caeduerqeer caeduerqeer caeduerqere caeduereqre caeduereqer
caeduererqe caeduerereq caeduereerq caeduereeqr caeduereqer caeduereqre caeduereeqr caeduereerq caeduerereq caeduererqe
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer
caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru
caedeereuqr caedeereurq caedeereruq caedeererqu caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ
caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer caedeerurqe caedeerureq
caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu caedeeqrrue caedeeqrreu
caedeeqrure caedeeqruer caedeeqreur caedeeqreru caedeeqrrue caedeeqrreu caedeeqrure caedeeqruer caedeeqreur caedeeqreru
caedeequrre caedeequrer caedeequrre caedeequrer caedeequerr caedeequerr caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr
caedeeqerur caedeeqerru caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr caedeeuqrre caedeeuqrer
caedeeuqrre caedeeuqrer caedeeuqerr caedeeuqerr caedeeurqre caedeeurqer caedeeurrqe caedeeurreq caedeeurerq caedeeureqr
caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq
caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr
caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu
caedererque caedererqeu caedereruqe caedererueq caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer
caedereqeur caedereqeru caedereuqre caedereuqer caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru
caedereeuqr caedereeurq caedereeruq caedereerqu caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ
caederrqeue caederrqeeu caederrquee caederrquee caederrqeue caederrqeeu caederruqee caederruqee caederrueqe caederrueeq
caederrueeq caederrueqe caederreque caederreqeu caederreuqe caederreueq caederreeuq caederreequ caederqreue caederqreeu
caederqruee caederqruee caederqreue caederqreeu caederqerue caederqereu caederqeure caederqeuer caederqeeur caederqeeru
caederquere caederqueer caederquree caederquree caederquere caederqueer caederqeeur caederqeeru caederqeuer caederqeure
caederqerue caederqereu caederurqee caederurqee caederureqe caederureeq caederureeq caederureqe caederuqree caederuqree
caederuqere caederuqeer caederuqeer caederuqere caederueqre caederueqer caederuerqe caederuereq caederueerq caederueeqr
caederueqer caederueqre caederueeqr caederueerq caederuereq caederuerqe caedererque caedererqeu caedereruqe caedererueq
caederereuq caedererequ caedereqrue caedereqreu caederequre caederequer caedereqeur caedereqeru caedereuqre caedereuqer
caedereurqe caedereureq caedereuerq caedereueqr caedereequr caedereeqru caedereeuqr caedereeurq caedereeruq caedereerqu
caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqeurre caedeqeurer caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru
caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqrreue caedeqrreeu caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqruree caedeqruree caedeqruere caedeqrueer
caedeqrueer caedeqruere caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru caedeqrreue caedeqrreeu
caedeqrruee caedeqrruee caedeqrreue caedeqrreeu caedeqrerue caedeqrereu caedeqreure caedeqreuer caedeqreeur caedeqreeru
caedeqruere caedeqrueer caedeqruree caedeqruree caedeqruere caedeqrueer caedeqreeur caedeqreeru caedeqreuer caedeqreure
caedeqrerue caedeqrereu caedequrree caedequrree caedequrere caedequreer caedequreer caedequrere caedequrree caedequrree
caedequrere caedequreer caedequreer caedequrere caedequerre caedequerer caedequerre caedequerer caedequeerr caedequeerr
caedequerer caedequerre caedequeerr caedequeerr caedequerer caedequerre caedeqerrue caedeqerreu caedeqerure caedeqeruer
caedeqereur caedeqereru caedeqerrue caedeqerreu caedeqerure caedeqeruer caedeqereur caedeqereru caedeqeurre caedeqeurer
caedeqeurre caedeqeurer caedeqeuerr caedeqeuerr caedeqeerur caedeqeerru caedeqeeurr caedeqeeurr caedeqeerur caedeqeerru
caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer
caedeueqerr caedeueqerr caedeuerqre caedeuerqer caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr
caedeueerqr caedeueerrq caedeueerrq caedeueerqr caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeurqere caedeurqeer caedeurqree caedeurqree caedeurqere caedeurqeer caedeurrqee caedeurrqee caedeurreqe caedeurreeq
caedeurreeq caedeurreqe caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr caedeuqrere caedeuqreer
caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqerre caedeuqerer caedeuqerre caedeuqerer caedeuqeerr caedeuqeerr
caedeuqrere caedeuqreer caedeuqrree caedeuqrree caedeuqrere caedeuqreer caedeuqeerr caedeuqeerr caedeuqerer caedeuqerre
caedeuqerre caedeuqerer caedeurrqee caedeurrqee caedeurreqe caedeurreeq caedeurreeq caedeurreqe caedeurqree caedeurqree
caedeurqere caedeurqeer caedeurqeer caedeurqere caedeureqre caedeureqer caedeurerqe caedeurereq caedeureerq caedeureeqr
caedeureqer caedeureqre caedeureeqr caedeureerq caedeurereq caedeurerqe caedeuerqre caedeuerqer caedeuerrqe caedeuerreq
caedeuererq caedeuereqr caedeueqrre caedeueqrer caedeueqrre caedeueqrer caedeueqerr caedeueqerr caedeuerqre caedeuerqer
caedeuerrqe caedeuerreq caedeuererq caedeuereqr caedeueeqrr caedeueeqrr caedeueerqr caedeueerrq caedeueerrq caedeueerqr
caedeeerqur caedeeerqru caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeeeqrur caedeeeqrru caedeeequrr caedeeequrr
caedeeeqrur caedeeeqrru caedeeeuqrr caedeeeuqrr caedeeeurqr caedeeeurrq caedeeeurrq caedeeeurqr caedeeerqur caedeeerqru
caedeeeruqr caedeeerurq caedeeerruq caedeeerrqu caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu
caedeerqeur caedeerqeru caedeerquer caedeerqure caedeerqrue caedeerqreu caedeeruqer caedeeruqre caedeerueqr caedeeruerq
caedeerureq caedeerurqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq caedeerreuq caedeerrequ caedeeqreur caedeeqreru
caedeeqruer caedeeqrure caedeeqrrue caedeeqrreu caedeeqerur caedeeqerru caedeeqeurr caedeeqeurr caedeeqerur caedeeqerru
caedeequerr caedeequerr caedeequrer caedeequrre caedeequrre caedeequrer caedeeqreur caedeeqreru caedeeqruer caedeeqrure
caedeeqrrue caedeeqrreu caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeeuqrer caedeeuqrre
caedeeuqerr caedeeuqerr caedeeuqrer caedeeuqrre caedeeueqrr caedeeueqrr caedeeuerqr caedeeuerrq caedeeuerrq caedeeuerqr
caedeeurqer caedeeurqre caedeeureqr caedeeurerq caedeeurreq caedeeurrqe caedeerrque caedeerrqeu caedeerruqe caedeerrueq
caedeerreuq caedeerrequ caedeerqrue caedeerqreu caedeerqure caedeerquer caedeerqeur caedeerqeru caedeeruqre caedeeruqer
caedeerurqe caedeerureq caedeeruerq caedeerueqr caedeerequr caedeereqru caedeereuqr caedeereurq caedeereruq caedeererqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us