easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

brahmanhood

castigatus

exorcistic

craniometrical

eponychium

minxes

imperabitis

enchondromatous

ahlert

blackbear

latchaw

crucily

encephalopsychesis

schlee

underface

memoraveris

restored

lapidating


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: buyout
cipher variations:
cvzpvu dwaqwv exbrxw fycsyx gzdtzy
haeuaz ibfvba jcgwcb kdhxdc leiyed
mfjzfe ngkagf ohlbhg pimcih qjndji
rkoekj slpflk tmqgml unrhnm vosion
wptjpo xqukqp yrvlrq zswmsr atxnts

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: buyout
Cipher: yfblfg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: buyout
Cipher: AAAAB BAABB BABBA ABBAB BAABB BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: buyout
cipher variations:
cvzpvuejvrjggxrtxsilnvlekzjxzqmnfzncqpxdpasdtfdm
urphrywfljfkythltwahdnhidwaqwvfkwskhhysuytjmowmf
lakyarnogaodrqyeqbteugenvsqiszxgmkglzuimuxbieoij
exbrxwglxtliiztvzuknpxngmblzbsophbpesrzfrcufvhfo
wtrjtayhnlhmavjnvycjfpjkfycsyxhmyumjjauwavloqyoh
ncmactpqicqftsagsdvgwigpxuskubziominbwkowzdkgqkl
gzdtzyinzvnkkbvxbwmprzpiodnbduqrjdrgutbhtewhxjhq
yvtlvcajpnjocxlpxaelhrlmhaeuazjoawollcwycxnqsaqj
peocevrskeshvuciufxiykirzwumwdbkqokpdymqybfmismn
ibfvbakpbxpmmdxzdyortbrkqfpdfwstlftiwvdjvgyjzljs
axvnxeclrplqeznrzcgnjtnojcgwcblqcyqnneyaezpsucsl
rgqegxtumgujxwekwhzkamktbywoyfdmsqmrfaosadhokuop
kdhxdcmrdzroofzbfaqtvdtmshrfhyuvnhvkyxflxialbnlu
czxpzgentrnsgbptbeiplvpqleiyednseasppgacgbruweun
tisgizvwoiwlzygmyjbmcomvdayqahfousothcqucfjqmwqr
mfjzfeotfbtqqhbdhcsvxfvoujthjawxpjxmazhnzkcndpnw
ebzrbigpvtpuidrvdgkrnxrsngkagfpugcurriceidtwygwp
vkuikbxyqkynbaioaldoeqoxfcascjhqwuqvjeswehlsoyst
ohlbhgqvhdvssjdfjeuxzhxqwlvjlcyzrlzocbjpbmepfrpy
gdbtdkirxvrwkftxfimtpztupimcihrwiewttkegkfvyaiyr
xmwkmdzasmapdckqcnfqgsqzhecueljsywsxlguygjnuqauv
qjndjisxjfxuulfhlgwzbjzsynxlneabtnbqedlrdogrhtra
ifdvfmktzxtymhvzhkovrbvwrkoekjtykgyvvmgimhxackat
zoymofbcuocrfemsephsiusbjgewgnluayuzniwailpwscwx
slpflkuzlhzwwnhjniybdlbuapznpgcdvpdsgfntfqitjvtc
khfxhomvbzvaojxbjmqxtdxytmqgmlvamiaxxoikojzcemcv
bqaoqhdewqethgougrjukwudligyipnwcawbpkycknryueyz
unrhnmwbnjbyypjlpkadfndwcrbpriefxrfuihpvhskvlxve
mjhzjqoxdbxcqlzdloszvfzavosionxcokczzqkmqlbegoex
dscqsjfgysgvjiqwitlwmywfnkiakrpyecydrmaemptawgab
wptjpoydpldaarlnrmcfhpfyetdrtkghzthwkjrxjumxnzxg
oljblsqzfdzesnbfnqubxhbcxqukqpzeqmebbsmosndgiqgz
fuesulhiauixlksykvnyoayhpmkcmtrageaftocgorvcyicd
yrvlrqafrnfcctnptoehjrhagvftvmijbvjymltzlwozpbzi
qnldnusbhfbgupdhpswdzjdezswmsrbgsogdduoqupfiksib
hwguwnjkcwkznmuamxpaqcajromeovtcigchvqeiqtxeakef
atxntschtpheevprvqgjltjcixhvxokldxlaonvbnyqbrdbk
spnfpwudjhdiwrfjruyfblfgbuyoutdiuqiffwqswrhkmukd
jyiwyplmeymbpowcozrcsecltqogqxvekiejxsgksvzgcmgh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: buyout
Cipher: ohlbhg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: buyout
Cipher: 215445435444

Extended Methods:
Method #1

Plaintext: buyout
method variations:
gzdtzymeiyedrkodkiwptipo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b u y o u t 
2 5 4 4 5 4 
1 4 5 3 4 4 
They are then read out in rows:
254454145344
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: buyout
Cipher: wtuqpt

Read more ...
Method #3

Plaintext: buyout
method variations:
vtuxti tuxtiv uxtivt
xtivtu tivtux ivtuxt

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: buyout

all 720 cipher variations:
buyout buyotu buyuot buyuto buytuo buytou buoyut buoytu buouyt buouty buotuy
buotyu buuoyt buuoty buuyot buuyto buutyo buutoy butouy butoyu butuoy butuyo
butyuo butyou byuout byuotu byuuot byuuto byutuo byutou byouut byoutu byouut
byoutu byotuu byotuu byuout byuotu byuuot byuuto byutuo byutou bytouu bytouu
bytuou bytuuo bytuuo bytuou boyuut boyutu boyuut boyutu boytuu boytuu bouyut
bouytu bouuyt bouuty boutuy boutyu bouuyt bouuty bouyut bouytu boutyu boutuy
botuuy botuyu botuuy botuyu botyuu botyuu buyout buyotu buyuot buyuto buytuo
buytou buoyut buoytu buouyt buouty buotuy buotyu buuoyt buuoty buuyot buuyto
buutyo buutoy butouy butoyu butuoy butuyo butyuo butyou btyouu btyouu btyuou
btyuuo btyuuo btyuou btoyuu btoyuu btouyu btouuy btouuy btouyu btuoyu btuouy
btuyou btuyuo btuuyo btuuoy btuouy btuoyu btuuoy btuuyo btuyuo btuyou ubyout
ubyotu ubyuot ubyuto ubytuo ubytou uboyut uboytu ubouyt ubouty ubotuy ubotyu
ubuoyt ubuoty ubuyot ubuyto ubutyo ubutoy ubtouy ubtoyu ubtuoy ubtuyo ubtyuo
ubtyou uybout uybotu uybuot uybuto uybtuo uybtou uyobut uyobtu uyoubt uyoutb
uyotub uyotbu uyuobt uyuotb uyubot uyubto uyutbo uyutob uytoub uytobu uytuob
uytubo uytbuo uytbou uoybut uoybtu uoyubt uoyutb uoytub uoytbu uobyut uobytu
uobuyt uobuty uobtuy uobtyu uoubyt uoubty uouybt uouytb uoutyb uoutby uotbuy
uotbyu uotuby uotuyb uotyub uotybu uuyobt uuyotb uuybot uuybto uuytbo uuytob
uuoybt uuoytb uuobyt uuobty uuotby uuotyb uuboyt uuboty uubyot uubyto uubtyo
uubtoy uutoby uutoyb uutboy uutbyo uutybo uutyob utyoub utyobu utyuob utyubo
utybuo utybou utoyub utoybu utouyb utouby utobuy utobyu utuoyb utuoby utuyob
utuybo utubyo utuboy utbouy utboyu utbuoy utbuyo utbyuo utbyou yubout yubotu
yubuot yubuto yubtuo yubtou yuobut yuobtu yuoubt yuoutb yuotub yuotbu yuuobt
yuuotb yuubot yuubto yuutbo yuutob yutoub yutobu yutuob yutubo yutbuo yutbou
ybuout ybuotu ybuuot ybuuto ybutuo ybutou ybouut yboutu ybouut yboutu ybotuu
ybotuu ybuout ybuotu ybuuot ybuuto ybutuo ybutou ybtouu ybtouu ybtuou ybtuuo
ybtuuo ybtuou yobuut yobutu yobuut yobutu yobtuu yobtuu youbut youbtu youubt
youutb youtub youtbu youubt youutb youbut youbtu youtbu youtub yotuub yotubu
yotuub yotubu yotbuu yotbuu yubout yubotu yubuot yubuto yubtuo yubtou yuobut
yuobtu yuoubt yuoutb yuotub yuotbu yuuobt yuuotb yuubot yuubto yuutbo yuutob
yutoub yutobu yutuob yutubo yutbuo yutbou ytbouu ytbouu ytbuou ytbuuo ytbuuo
ytbuou ytobuu ytobuu ytoubu ytouub ytouub ytoubu ytuobu ytuoub ytubou ytubuo
ytuubo ytuuob ytuoub ytuobu ytuuob ytuubo ytubuo ytubou ouybut ouybtu ouyubt
ouyutb ouytub ouytbu oubyut oubytu oubuyt oubuty oubtuy oubtyu ouubyt ouubty
ouuybt ouuytb ouutyb ouutby outbuy outbyu outuby outuyb outyub outybu oyubut
oyubtu oyuubt oyuutb oyutub oyutbu oybuut oybutu oybuut oybutu oybtuu oybtuu
oyubut oyubtu oyuubt oyuutb oyutub oyutbu oytbuu oytbuu oytubu oytuub oytuub
oytubu obyuut obyutu obyuut obyutu obytuu obytuu obuyut obuytu obuuyt obuuty
obutuy obutyu obuuyt obuuty obuyut obuytu obutyu obutuy obtuuy obtuyu obtuuy
obtuyu obtyuu obtyuu ouybut ouybtu ouyubt ouyutb ouytub ouytbu oubyut oubytu
oubuyt oubuty oubtuy oubtyu ouubyt ouubty ouuybt ouuytb ouutyb ouutby outbuy
outbyu outuby outuyb outyub outybu otybuu otybuu otyubu otyuub otyuub otyubu
otbyuu otbyuu otbuyu otbuuy otbuuy otbuyu otubyu otubuy otuybu otuyub otuuyb
otuuby otubuy otubyu otuuby otuuyb otuyub otuybu uuyobt uuyotb uuybot uuybto
uuytbo uuytob uuoybt uuoytb uuobyt uuobty uuotby uuotyb uuboyt uuboty uubyot
uubyto uubtyo uubtoy uutoby uutoyb uutboy uutbyo uutybo uutyob uyuobt uyuotb
uyubot uyubto uyutbo uyutob uyoubt uyoutb uyobut uyobtu uyotbu uyotub uybout
uybotu uybuot uybuto uybtuo uybtou uytobu uytoub uytbou uytbuo uytubo uytuob
uoyubt uoyutb uoybut uoybtu uoytbu uoytub uouybt uouytb uoubyt uoubty uoutby
uoutyb uobuyt uobuty uobyut uobytu uobtyu uobtuy uotuby uotuyb uotbuy uotbyu
uotybu uotyub ubyout ubyotu ubyuot ubyuto ubytuo ubytou uboyut uboytu ubouyt
ubouty ubotuy ubotyu ubuoyt ubuoty ubuyot ubuyto ubutyo ubutoy ubtouy ubtoyu
ubtuoy ubtuyo ubtyuo ubtyou utyobu utyoub utybou utybuo utyubo utyuob utoybu
utoyub utobyu utobuy utouby utouyb utboyu utbouy utbyou utbyuo utbuyo utbuoy
utuoby utuoyb utuboy utubyo utuybo utuyob tuyoub tuyobu tuyuob tuyubo tuybuo
tuybou tuoyub tuoybu tuouyb tuouby tuobuy tuobyu tuuoyb tuuoby tuuyob tuuybo
tuubyo tuuboy tubouy tuboyu tubuoy tubuyo tubyuo tubyou tyuoub tyuobu tyuuob
tyuubo tyubuo tyubou tyouub tyoubu tyouub tyoubu tyobuu tyobuu tyuoub tyuobu
tyuuob tyuubo tyubuo tyubou tybouu tybouu tybuou tybuuo tybuuo tybuou toyuub
toyubu toyuub toyubu toybuu toybuu touyub touybu touuyb touuby toubuy toubyu
touuyb touuby touyub touybu toubyu toubuy tobuuy tobuyu tobuuy tobuyu tobyuu
tobyuu tuyoub tuyobu tuyuob tuyubo tuybuo tuybou tuoyub tuoybu tuouyb tuouby
tuobuy tuobyu tuuoyb tuuoby tuuyob tuuybo tuubyo tuuboy tubouy tuboyu tubuoy
tubuyo tubyuo tubyou tbyouu tbyouu tbyuou tbyuuo tbyuuo tbyuou tboyuu tboyuu
tbouyu tbouuy tbouuy tbouyu tbuoyu tbuouy tbuyou tbuyuo tbuuyo tbuuoy tbuouy
tbuoyu tbuuoy tbuuyo tbuyuo tbuyou

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us