easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

unscoring

pictoradiogram

schistocytosis

ultrapious

verticillary

unhumanize

soregi

yanked

dissmulatis

trotline

klonowski

asideness

coptis

perceivability

paraenetic

condescending

fichera

europocentric


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: bronton
cipher variations:
cspoupo dtqpvqp eurqwrq fvsrxsr gwtsyts
hxutzut iyvuavu jzwvbwv kaxwcxw lbyxdyx
mczyezy ndazfaz oebagba pfcbhcb qgdcidc
rhedjed sifekfe tjgflgf ukhgmhg vlihnih
wmjioji xnkjpkj yolkqlk zpmlrml aqnmsnm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: bronton
Cipher: yilmglm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: bronton
Cipher: AAAAB BAAAA ABBAB ABBAA BAABA ABBAB ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: bronton
cipher variations:
cspoupoearogrogitostoiqvoevokyxoqxomgzoczoqwdoadosefomfo
umhoyhowujokjoyclowloaknoinodtqpvqpfbsphsphjuptupjrwpfwp
lzyprypnhapdaprxepbeptfgpngpvnipzipxvkplkpzdmpxmpblopjop
eurqwrqgctqitqikvquvqksxqgxqmazqszqoibqebqsyfqcfqughqohq
wojqajqywlqmlqaenqynqcmpqkpqfvsrxsrhdurjurjlwrvwrltyrhyr
nbartarpjcrfcrtzgrdgrvhirpirxpkrbkrzxmrnmrbforzordnqrlqr
gwtsytsievskvskmxswxsmuzsizsocbsubsqkdsgdsuahsehswijsqjs
yqlsclsaynsonscgpsapseorsmrshxutzutjfwtlwtlnytxytnvatjat
pdctvctrlethetvbitfitxjktrktzrmtdmtbzotpotdhqtbqtfpstnst
iyvuavukgxumxumozuyzuowbukbuqeduwdusmfuifuwcjugjuykluslu
asnuenucapuqpueirucrugqtuotujzwvbwvlhyvnyvnpavzavpxcvlcv
rfevxevtngvjgvxdkvhkvzlmvtmvbtovfovdbqvrqvfjsvdsvhruvpuv
kaxwcxwmizwozwoqbwabwqydwmdwsgfwyfwuohwkhwyelwilwamnwunw
cupwgpwecrwsrwgktwetwisvwqvwlbyxdyxnjaxpaxprcxbcxrzexnex
thgxzgxvpixlixzfmxjmxbnoxvoxdvqxhqxfdsxtsxhluxfuxjtwxrwx
mczyezyokbyqbyqsdycdysafyofyuihyahywqjymjyagnyknycopywpy
ewryirygetyutyimvygvykuxysxyndazfazplczrczrtezdeztbgzpgz
vjizbizxrkznkzbhozlozdpqzxqzfxszjszhfuzvuzjnwzhwzlvyztyz
oebagbaqmdasdasufaefauchaqhawkjacjayslaolacipampaeqrayra
gytaktaigvawvakoxaixamwzauzapfcbhcbrnebtebtvgbfgbvdibrib
xlkbdkbztmbpmbdjqbnqbfrsbzsbhzublubjhwbxwblpybjybnxabvab
qgdcidcsofcufcuwhcghcwejcsjcymlcelcauncqncekrcorcgstcatc
iavcmvckixcyxcmqzckzcoybcwbcrhedjedtpgdvgdvxidhidxfkdtkd
znmdfmdbvodrodflsdpsdhtudbudjbwdnwdljydzydnradladpzcdxcd
sifekfeuqhewhewyjeijeygleuleaonegnecwpespegmteqteiuvecve
kcxeoxemkzeazeosbembeqadeydetjgflgfvrifxifxzkfjkfzhmfvmf
bpofhofdxqftqfhnufrufjvwfdwfldyfpyfnlafbafptcfncfrbefzef
ukhgmhgwsjgyjgyalgklgaingwngcqpgipgeyrgurgiovgsvgkwxgexg
mezgqzgombgcbgqudgodgscfgafgvlihnihxtkhzkhzbmhlmhbjohxoh
drqhjqhfzshvshjpwhtwhlxyhfyhnfahrahpnchdchrvehpehtdghbgh
wmjiojiyulialiacnimnickpiypiesrikrigatiwtikqxiuximyzigzi
ogbisbiqodiediswfiqfiuehichixnkjpkjzvmjbmjbdojnojdlqjzqj
ftsjlsjhbujxujlryjvyjnzajhajphcjtcjrpejfejtxgjrgjvfijdij
yolkqlkawnkcnkcepkopkemrkarkgutkmtkicvkyvkmszkwzkoabkibk
qidkudksqfkgfkuyhkshkwgjkejkzpmlrmlbxoldoldfqlpqlfnslbsl
hvulnuljdwlzwlntalxalpbcljclrjelveltrglhglvziltilxhklfkl
aqnmsnmcypmepmegrmqrmgotmctmiwvmovmkexmaxmoubmybmqcdmkdm
skfmwfmushmihmwajmujmyilmglmbrontondzqnfqnfhsnrsnhpundun
jxwnpwnlfynbynpvcnzcnrdenlentlgnxgnvtinjinxbknvknzjmnhmn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: bronton
Cipher: oebagba

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: bronton
Cipher: 21244333444333

Extended Methods:
Method #1

Plaintext: bronton
method variations:
gwtsytsmbyxdyxrgdcidcwmihoih

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b r o n t o n 
2 2 4 3 4 4 3 
1 4 3 3 4 3 3 
They are then read out in rows:
22434431433433
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: bronton
Cipher: gotcosn

Read more ...
Method #3

Plaintext: bronton
method variations:
ftnstnh tnstnhf nstnhft
stnhftn tnhftns nhftnst
hftnstn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: bronton

all 5040 cipher variations:
bronton brontno bronotn bronont bronnot bronnto brotnon brotnno brotonn brotonn brotnon
brotnno brootnn brootnn broontn broonnt broonnt broontn bronton brontno bronotn bronont
bronnot bronnto brnoton brnotno brnootn brnoont brnonot brnonto brntoon brntono brntoon
brntono brntnoo brntnoo brnoton brnotno brnootn brnoont brnonot brnonto brnntoo brnntoo
brnnoto brnnoot brnnoot brnnoto brtnoon brtnono brtnoon brtnono brtnnoo brtnnoo brtonon
brtonno brtoonn brtoonn brtonon brtonno brtoonn brtoonn brtonon brtonno brtonno brtonon
brtnoon brtnono brtnoon brtnono brtnnoo brtnnoo bronton brontno bronotn bronont bronnot
bronnto brotnon brotnno brotonn brotonn brotnon brotnno brootnn brootnn broontn broonnt
broonnt broontn bronton brontno bronotn bronont bronnot bronnto brnntoo brnntoo brnnoto
brnnoot brnnoot brnnoto brntnoo brntnoo brntono brntoon brntoon brntono brnotno brnoton
brnonto brnonot brnoont brnootn brnoton brnotno brnootn brnoont brnonot brnonto bornton
borntno bornotn bornont bornnot bornnto bortnon bortnno bortonn bortonn bortnon bortnno
borotnn borotnn borontn boronnt boronnt borontn bornton borntno bornotn bornont bornnot
bornnto bonrton bonrtno bonrotn bonront bonrnot bonrnto bontron bontrno bontorn bontonr
bontnor bontnro bonotrn bonotnr bonortn bonornt bononrt bonontr bonntor bonntro bonnotr
bonnort bonnrot bonnrto botnron botnrno botnorn botnonr botnnor botnnro botrnon botrnno
botronn botronn botrnon botrnno botornn botornn botonrn botonnr botonnr botonrn botnron
botnrno botnorn botnonr botnnor botnnro boontrn boontnr boonrtn boonrnt boonnrt boonntr
bootnrn bootnnr bootrnn bootrnn bootnrn bootnnr boortnn boortnn boorntn boornnt boornnt
boorntn boontrn boontnr boonrtn boonrnt boonnrt boonntr bonntor bonntro bonnotr bonnort
bonnrot bonnrto bontnor bontnro bontonr bontorn bontron bontrno bonotnr bonotrn bonontr
bononrt bonornt bonortn bonrton bonrtno bonrotn bonront bonrnot bonrnto bnorton bnortno
bnorotn bnoront bnornot bnornto bnotron bnotrno bnotorn bnotonr bnotnor bnotnro bnootrn
bnootnr bnoortn bnoornt bnoonrt bnoontr bnontor bnontro bnonotr bnonort bnonrot bnonrto
bnroton bnrotno bnrootn bnroont bnronot bnronto bnrtoon bnrtono bnrtoon bnrtono bnrtnoo
bnrtnoo bnroton bnrotno bnrootn bnroont bnronot bnronto bnrntoo bnrntoo bnrnoto bnrnoot
bnrnoot bnrnoto bntroon bntrono bntroon bntrono bntrnoo bntrnoo bntoron bntorno bntoorn
bntoonr bntonor bntonro bntoorn bntoonr bntoron bntorno bntonro bntonor bntnoor bntnoro
bntnoor bntnoro bntnroo bntnroo bnorton bnortno bnorotn bnoront bnornot bnornto bnotron
bnotrno bnotorn bnotonr bnotnor bnotnro bnootrn bnootnr bnoortn bnoornt bnoonrt bnoontr
bnontor bnontro bnonotr bnonort bnonrot bnonrto bnnrtoo bnnrtoo bnnroto bnnroot bnnroot
bnnroto bnntroo bnntroo bnntoro bnntoor bnntoor bnntoro bnnotro bnnotor bnnorto bnnorot
bnnoort bnnootr bnnotor bnnotro bnnootr bnnoort bnnorot bnnorto btonron btonrno btonorn
btononr btonnor btonnro btornon btornno btoronn btoronn btornon btornno btoornn btoornn
btoonrn btoonnr btoonnr btoonrn btonron btonrno btonorn btononr btonnor btonnro btnoron
btnorno btnoorn btnoonr btnonor btnonro btnroon btnrono btnroon btnrono btnrnoo btnrnoo
btnoron btnorno btnoorn btnoonr btnonor btnonro btnnroo btnnroo btnnoro btnnoor btnnoor
btnnoro btrnoon btrnono btrnoon btrnono btrnnoo btrnnoo btronon btronno btroonn btroonn
btronon btronno btroonn btroonn btronon btronno btronno btronon btrnoon btrnono btrnoon
btrnono btrnnoo btrnnoo btonron btonrno btonorn btononr btonnor btonnro btornon btornno
btoronn btoronn btornon btornno btoornn btoornn btoonrn btoonnr btoonnr btoonrn btonron
btonrno btonorn btononr btonnor btonnro btnnroo btnnroo btnnoro btnnoor btnnoor btnnoro
btnrnoo btnrnoo btnrono btnroon btnroon btnrono btnorno btnoron btnonro btnonor btnoonr
btnoorn btnoron btnorno btnoorn btnoonr btnonor btnonro boontrn boontnr boonrtn boonrnt
boonnrt boonntr bootnrn bootnnr bootrnn bootrnn bootnrn bootnnr boortnn boortnn boorntn
boornnt boornnt boorntn boontrn boontnr boonrtn boonrnt boonnrt boonntr bonotrn bonotnr
bonortn bonornt bononrt bonontr bontorn bontonr bontron bontrno bontnro bontnor bonrton
bonrtno bonrotn bonront bonrnot bonrnto bonntro bonntor bonnrto bonnrot bonnort bonnotr
botnorn botnonr botnron botnrno botnnro botnnor botonrn botonnr botornn botornn botonrn
botonnr botronn botronn botrnon botrnno botrnno botrnon botnorn botnonr botnron botnrno
botnnro botnnor bornton borntno bornotn bornont bornnot bornnto bortnon bortnno bortonn
bortonn bortnon bortnno borotnn borotnn borontn boronnt boronnt borontn bornton borntno
bornotn bornont bornnot bornnto bonntro bonntor bonnrto bonnrot bonnort bonnotr bontnro
bontnor bontrno bontron bontorn bontonr bonrtno bonrton bonrnto bonrnot bonront bonrotn
bonotrn bonotnr bonortn bonornt bononrt bonontr bnontor bnontro bnonotr bnonort bnonrot
bnonrto bnotnor bnotnro bnotonr bnotorn bnotron bnotrno bnootnr bnootrn bnoontr bnoonrt
bnoornt bnoortn bnorton bnortno bnorotn bnoront bnornot bnornto bnnotor bnnotro bnnootr
bnnoort bnnorot bnnorto bnntoor bnntoro bnntoor bnntoro bnntroo bnntroo bnnotor bnnotro
bnnootr bnnoort bnnorot bnnorto bnnrtoo bnnrtoo bnnroto bnnroot bnnroot bnnroto bntnoor
bntnoro bntnoor bntnoro bntnroo bntnroo bntonor bntonro bntoonr bntoorn bntoron bntorno
bntoonr bntoorn bntonor bntonro bntorno bntoron bntroon bntrono bntroon bntrono bntrnoo
bntrnoo bnontor bnontro bnonotr bnonort bnonrot bnonrto bnotnor bnotnro bnotonr bnotorn
bnotron bnotrno bnootnr bnootrn bnoontr bnoonrt bnoornt bnoortn bnorton bnortno bnorotn
bnoront bnornot bnornto bnrntoo bnrntoo bnrnoto bnrnoot bnrnoot bnrnoto bnrtnoo bnrtnoo
bnrtono bnrtoon bnrtoon bnrtono bnrotno bnroton bnronto bnronot bnroont bnrootn bnroton
bnrotno bnrootn bnroont bnronot bnronto rbonton rbontno rbonotn rbonont rbonnot rbonnto
rbotnon rbotnno rbotonn rbotonn rbotnon rbotnno rbootnn rbootnn rboontn rboonnt rboonnt
rboontn rbonton rbontno rbonotn rbonont rbonnot rbonnto rbnoton rbnotno rbnootn rbnoont
rbnonot rbnonto rbntoon rbntono rbntoon rbntono rbntnoo rbntnoo rbnoton rbnotno rbnootn
rbnoont rbnonot rbnonto rbnntoo rbnntoo rbnnoto rbnnoot rbnnoot rbnnoto rbtnoon rbtnono
rbtnoon rbtnono rbtnnoo rbtnnoo rbtonon rbtonno rbtoonn rbtoonn rbtonon rbtonno rbtoonn
rbtoonn rbtonon rbtonno rbtonno rbtonon rbtnoon rbtnono rbtnoon rbtnono rbtnnoo rbtnnoo
rbonton rbontno rbonotn rbonont rbonnot rbonnto rbotnon rbotnno rbotonn rbotonn rbotnon
rbotnno rbootnn rbootnn rboontn rboonnt rboonnt rboontn rbonton rbontno rbonotn rbonont
rbonnot rbonnto rbnntoo rbnntoo rbnnoto rbnnoot rbnnoot rbnnoto rbntnoo rbntnoo rbntono
rbntoon rbntoon rbntono rbnotno rbnoton rbnonto rbnonot rbnoont rbnootn rbnoton rbnotno
rbnootn rbnoont rbnonot rbnonto robnton robntno robnotn robnont robnnot robnnto robtnon
robtnno robtonn robtonn robtnon robtnno robotnn robotnn robontn robonnt robonnt robontn
robnton robntno robnotn robnont robnnot robnnto ronbton ronbtno ronbotn ronbont ronbnot
ronbnto rontbon rontbno rontobn rontonb rontnob rontnbo ronotbn ronotnb ronobtn ronobnt
rononbt ronontb ronntob ronntbo ronnotb ronnobt ronnbot ronnbto rotnbon rotnbno rotnobn
rotnonb rotnnob rotnnbo rotbnon rotbnno rotbonn rotbonn rotbnon rotbnno rotobnn rotobnn
rotonbn rotonnb rotonnb rotonbn rotnbon rotnbno rotnobn rotnonb rotnnob rotnnbo roontbn
roontnb roonbtn roonbnt roonnbt roonntb rootnbn rootnnb rootbnn rootbnn rootnbn rootnnb
roobtnn roobtnn roobntn roobnnt roobnnt roobntn roontbn roontnb roonbtn roonbnt roonnbt
roonntb ronntob ronntbo ronnotb ronnobt ronnbot ronnbto rontnob rontnbo rontonb rontobn
rontbon rontbno ronotnb ronotbn ronontb rononbt ronobnt ronobtn ronbton ronbtno ronbotn
ronbont ronbnot ronbnto rnobton rnobtno rnobotn rnobont rnobnot rnobnto rnotbon rnotbno
rnotobn rnotonb rnotnob rnotnbo rnootbn rnootnb rnoobtn rnoobnt rnoonbt rnoontb rnontob
rnontbo rnonotb rnonobt rnonbot rnonbto rnboton rnbotno rnbootn rnboont rnbonot rnbonto
rnbtoon rnbtono rnbtoon rnbtono rnbtnoo rnbtnoo rnboton rnbotno rnbootn rnboont rnbonot
rnbonto rnbntoo rnbntoo rnbnoto rnbnoot rnbnoot rnbnoto rntboon rntbono rntboon rntbono
rntbnoo rntbnoo rntobon rntobno rntoobn rntoonb rntonob rntonbo rntoobn rntoonb rntobon
rntobno rntonbo rntonob rntnoob rntnobo rntnoob rntnobo rntnboo rntnboo rnobton rnobtno
rnobotn rnobont rnobnot rnobnto rnotbon rnotbno rnotobn rnotonb rnotnob rnotnbo rnootbn
rnootnb rnoobtn rnoobnt rnoonbt rnoontb rnontob rnontbo rnonotb rnonobt rnonbot rnonbto
rnnbtoo rnnbtoo rnnboto rnnboot rnnboot rnnboto rnntboo rnntboo rnntobo rnntoob rnntoob
rnntobo rnnotbo rnnotob rnnobto rnnobot rnnoobt rnnootb rnnotob rnnotbo rnnootb rnnoobt
rnnobot rnnobto rtonbon rtonbno rtonobn rtononb rtonnob rtonnbo rtobnon rtobnno rtobonn
rtobonn rtobnon rtobnno rtoobnn rtoobnn rtoonbn rtoonnb rtoonnb rtoonbn rtonbon rtonbno
rtonobn rtononb rtonnob rtonnbo rtnobon rtnobno rtnoobn rtnoonb rtnonob rtnonbo rtnboon
rtnbono rtnboon rtnbono rtnbnoo rtnbnoo rtnobon rtnobno rtnoobn rtnoonb rtnonob rtnonbo
rtnnboo rtnnboo rtnnobo rtnnoob rtnnoob rtnnobo rtbnoon rtbnono rtbnoon rtbnono rtbnnoo
rtbnnoo rtbonon rtbonno rtboonn rtboonn rtbonon rtbonno rtboonn rtboonn rtbonon rtbonno
rtbonno rtbonon rtbnoon rtbnono rtbnoon rtbnono rtbnnoo rtbnnoo rtonbon rtonbno rtonobn
rtononb rtonnob rtonnbo rtobnon rtobnno rtobonn rtobonn rtobnon rtobnno rtoobnn rtoobnn
rtoonbn rtoonnb rtoonnb rtoonbn rtonbon rtonbno rtonobn rtononb rtonnob rtonnbo rtnnboo
rtnnboo rtnnobo rtnnoob rtnnoob rtnnobo rtnbnoo rtnbnoo rtnbono rtnboon rtnboon rtnbono
rtnobno rtnobon rtnonbo rtnonob rtnoonb rtnoobn rtnobon rtnobno rtnoobn rtnoonb rtnonob
rtnonbo roontbn roontnb roonbtn roonbnt roonnbt roonntb rootnbn rootnnb rootbnn rootbnn
rootnbn rootnnb roobtnn roobtnn roobntn roobnnt roobnnt roobntn roontbn roontnb roonbtn
roonbnt roonnbt roonntb ronotbn ronotnb ronobtn ronobnt rononbt ronontb rontobn rontonb
rontbon rontbno rontnbo rontnob ronbton ronbtno ronbotn ronbont ronbnot ronbnto ronntbo
ronntob ronnbto ronnbot ronnobt ronnotb rotnobn rotnonb rotnbon rotnbno rotnnbo rotnnob
rotonbn rotonnb rotobnn rotobnn rotonbn rotonnb rotbonn rotbonn rotbnon rotbnno rotbnno
rotbnon rotnobn rotnonb rotnbon rotnbno rotnnbo rotnnob robnton robntno robnotn robnont
robnnot robnnto robtnon robtnno robtonn robtonn robtnon robtnno robotnn robotnn robontn
robonnt robonnt robontn robnton robntno robnotn robnont robnnot robnnto ronntbo ronntob
ronnbto ronnbot ronnobt ronnotb rontnbo rontnob rontbno rontbon rontobn rontonb ronbtno
ronbton ronbnto ronbnot ronbont ronbotn ronotbn ronotnb ronobtn ronobnt rononbt ronontb
rnontob rnontbo rnonotb rnonobt rnonbot rnonbto rnotnob rnotnbo rnotonb rnotobn rnotbon
rnotbno rnootnb rnootbn rnoontb rnoonbt rnoobnt rnoobtn rnobton rnobtno rnobotn rnobont
rnobnot rnobnto rnnotob rnnotbo rnnootb rnnoobt rnnobot rnnobto rnntoob rnntobo rnntoob
rnntobo rnntboo rnntboo rnnotob rnnotbo rnnootb rnnoobt rnnobot rnnobto rnnbtoo rnnbtoo
rnnboto rnnboot rnnboot rnnboto rntnoob rntnobo rntnoob rntnobo rntnboo rntnboo rntonob
rntonbo rntoonb rntoobn rntobon rntobno rntoonb rntoobn rntonob rntonbo rntobno rntobon
rntboon rntbono rntboon rntbono rntbnoo rntbnoo rnontob rnontbo rnonotb rnonobt rnonbot
rnonbto rnotnob rnotnbo rnotonb rnotobn rnotbon rnotbno rnootnb rnootbn rnoontb rnoonbt
rnoobnt rnoobtn rnobton rnobtno rnobotn rnobont rnobnot rnobnto rnbntoo rnbntoo rnbnoto
rnbnoot rnbnoot rnbnoto rnbtnoo rnbtnoo rnbtono rnbtoon rnbtoon rnbtono rnbotno rnboton
rnbonto rnbonot rnboont rnbootn rnboton rnbotno rnbootn rnboont rnbonot rnbonto orbnton
orbntno orbnotn orbnont orbnnot orbnnto orbtnon orbtnno orbtonn orbtonn orbtnon orbtnno
orbotnn orbotnn orbontn orbonnt orbonnt orbontn orbnton orbntno orbnotn orbnont orbnnot
orbnnto ornbton ornbtno ornbotn ornbont ornbnot ornbnto orntbon orntbno orntobn orntonb
orntnob orntnbo ornotbn ornotnb ornobtn ornobnt ornonbt ornontb ornntob ornntbo ornnotb
ornnobt ornnbot ornnbto ortnbon ortnbno ortnobn ortnonb ortnnob ortnnbo ortbnon ortbnno
ortbonn ortbonn ortbnon ortbnno ortobnn ortobnn ortonbn ortonnb ortonnb ortonbn ortnbon
ortnbno ortnobn ortnonb ortnnob ortnnbo orontbn orontnb oronbtn oronbnt oronnbt oronntb
orotnbn orotnnb orotbnn orotbnn orotnbn orotnnb orobtnn orobtnn orobntn orobnnt orobnnt
orobntn orontbn orontnb oronbtn oronbnt oronnbt oronntb ornntob ornntbo ornnotb ornnobt
ornnbot ornnbto orntnob orntnbo orntonb orntobn orntbon orntbno ornotnb ornotbn ornontb
ornonbt ornobnt ornobtn ornbton ornbtno ornbotn ornbont ornbnot ornbnto obrnton obrntno
obrnotn obrnont obrnnot obrnnto obrtnon obrtnno obrtonn obrtonn obrtnon obrtnno obrotnn
obrotnn obrontn obronnt obronnt obrontn obrnton obrntno obrnotn obrnont obrnnot obrnnto
obnrton obnrtno obnrotn obnront obnrnot obnrnto obntron obntrno obntorn obntonr obntnor
obntnro obnotrn obnotnr obnortn obnornt obnonrt obnontr obnntor obnntro obnnotr obnnort
obnnrot obnnrto obtnron obtnrno obtnorn obtnonr obtnnor obtnnro obtrnon obtrnno obtronn
obtronn obtrnon obtrnno obtornn obtornn obtonrn obtonnr obtonnr obtonrn obtnron obtnrno
obtnorn obtnonr obtnnor obtnnro obontrn obontnr obonrtn obonrnt obonnrt obonntr obotnrn
obotnnr obotrnn obotrnn obotnrn obotnnr obortnn obortnn oborntn obornnt obornnt oborntn
obontrn obontnr obonrtn obonrnt obonnrt obonntr obnntor obnntro obnnotr obnnort obnnrot
obnnrto obntnor obntnro obntonr obntorn obntron obntrno obnotnr obnotrn obnontr obnonrt
obnornt obnortn obnrton obnrtno obnrotn obnront obnrnot obnrnto onbrton onbrtno onbrotn
onbront onbrnot onbrnto onbtron onbtrno onbtorn onbtonr onbtnor onbtnro onbotrn onbotnr
onbortn onbornt onbonrt onbontr onbntor onbntro onbnotr onbnort onbnrot onbnrto onrbton
onrbtno onrbotn onrbont onrbnot onrbnto onrtbon onrtbno onrtobn onrtonb onrtnob onrtnbo
onrotbn onrotnb onrobtn onrobnt onronbt onrontb onrntob onrntbo onrnotb onrnobt onrnbot
onrnbto ontrbon ontrbno ontrobn ontronb ontrnob ontrnbo ontbron ontbrno ontborn ontbonr
ontbnor ontbnro ontobrn ontobnr ontorbn ontornb ontonrb ontonbr ontnbor ontnbro ontnobr
ontnorb ontnrob ontnrbo onortbn onortnb onorbtn onorbnt onornbt onorntb onotrbn onotrnb
onotbrn onotbnr onotnbr onotnrb onobtrn onobtnr onobrtn onobrnt onobnrt onobntr onontbr
onontrb ononbtr ononbrt ononrbt ononrtb onnrtob onnrtbo onnrotb onnrobt onnrbot onnrbto
onntrob onntrbo onntorb onntobr onntbor onntbro onnotrb onnotbr onnortb onnorbt onnobrt
onnobtr onnbtor onnbtro onnbotr onnbort onnbrot onnbrto otbnron otbnrno otbnorn otbnonr
otbnnor otbnnro otbrnon otbrnno otbronn otbronn otbrnon otbrnno otbornn otbornn otbonrn
otbonnr otbonnr otbonrn otbnron otbnrno otbnorn otbnonr otbnnor otbnnro otnbron otnbrno
otnborn otnbonr otnbnor otnbnro otnrbon otnrbno otnrobn otnronb otnrnob otnrnbo otnorbn
otnornb otnobrn otnobnr otnonbr otnonrb otnnrob otnnrbo otnnorb otnnobr otnnbor otnnbro
otrnbon otrnbno otrnobn otrnonb otrnnob otrnnbo otrbnon otrbnno otrbonn otrbonn otrbnon
otrbnno otrobnn otrobnn otronbn otronnb otronnb otronbn otrnbon otrnbno otrnobn otrnonb
otrnnob otrnnbo otonrbn otonrnb otonbrn otonbnr otonnbr otonnrb otornbn otornnb otorbnn
otorbnn otornbn otornnb otobrnn otobrnn otobnrn otobnnr otobnnr otobnrn otonrbn otonrnb
otonbrn otonbnr otonnbr otonnrb otnnrob otnnrbo otnnorb otnnobr otnnbor otnnbro otnrnob
otnrnbo otnronb otnrobn otnrbon otnrbno otnornb otnorbn otnonrb otnonbr otnobnr otnobrn
otnbron otnbrno otnborn otnbonr otnbnor otnbnro oobntrn oobntnr oobnrtn oobnrnt oobnnrt
oobnntr oobtnrn oobtnnr oobtrnn oobtrnn oobtnrn oobtnnr oobrtnn oobrtnn oobrntn oobrnnt
oobrnnt oobrntn oobntrn oobntnr oobnrtn oobnrnt oobnnrt oobnntr oonbtrn oonbtnr oonbrtn
oonbrnt oonbnrt oonbntr oontbrn oontbnr oontrbn oontrnb oontnrb oontnbr oonrtbn oonrtnb
oonrbtn oonrbnt oonrnbt oonrntb oonntrb oonntbr oonnrtb oonnrbt oonnbrt oonnbtr ootnbrn
ootnbnr ootnrbn ootnrnb ootnnrb ootnnbr ootbnrn ootbnnr ootbrnn ootbrnn ootbnrn ootbnnr
ootrbnn ootrbnn ootrnbn ootrnnb ootrnnb ootrnbn ootnbrn ootnbnr ootnrbn ootnrnb ootnnrb
ootnnbr oorntbn oorntnb oornbtn oornbnt oornnbt oornntb oortnbn oortnnb oortbnn oortbnn
oortnbn oortnnb oorbtnn oorbtnn oorbntn oorbnnt oorbnnt oorbntn oorntbn oorntnb oornbtn
oornbnt oornnbt oornntb oonntrb oonntbr oonnrtb oonnrbt oonnbrt oonnbtr oontnrb oontnbr
oontrnb oontrbn oontbrn oontbnr oonrtnb oonrtbn oonrntb oonrnbt oonrbnt oonrbtn oonbtrn
oonbtnr oonbrtn oonbrnt oonbnrt oonbntr onbntor onbntro onbnotr onbnort onbnrot onbnrto
onbtnor onbtnro onbtonr onbtorn onbtron onbtrno onbotnr onbotrn onbontr onbonrt onbornt
onbortn onbrton onbrtno onbrotn onbront onbrnot onbrnto onnbtor onnbtro onnbotr onnbort
onnbrot onnbrto onntbor onntbro onntobr onntorb onntrob onntrbo onnotbr onnotrb onnobtr
onnobrt onnorbt onnortb onnrtob onnrtbo onnrotb onnrobt onnrbot onnrbto ontnbor ontnbro
ontnobr ontnorb ontnrob ontnrbo ontbnor ontbnro ontbonr ontborn ontbron ontbrno ontobnr
ontobrn ontonbr ontonrb ontornb ontorbn ontrbon ontrbno ontrobn ontronb ontrnob ontrnbo
onontbr onontrb ononbtr ononbrt ononrbt ononrtb onotnbr onotnrb onotbnr onotbrn onotrbn
onotrnb onobtnr onobtrn onobntr onobnrt onobrnt onobrtn onortbn onortnb onorbtn onorbnt
onornbt onorntb onrntob onrntbo onrnotb onrnobt onrnbot onrnbto onrtnob onrtnbo onrtonb
onrtobn onrtbon onrtbno onrotnb onrotbn onrontb onronbt onrobnt onrobtn onrbton onrbtno
onrbotn onrbont onrbnot onrbnto nrobton nrobtno nrobotn nrobont nrobnot nrobnto nrotbon
nrotbno nrotobn nrotonb nrotnob nrotnbo nrootbn nrootnb nroobtn nroobnt nroonbt nroontb
nrontob nrontbo nronotb nronobt nronbot nronbto nrboton nrbotno nrbootn nrboont nrbonot
nrbonto nrbtoon nrbtono nrbtoon nrbtono nrbtnoo nrbtnoo nrboton nrbotno nrbootn nrboont
nrbonot nrbonto nrbntoo nrbntoo nrbnoto nrbnoot nrbnoot nrbnoto nrtboon nrtbono nrtboon
nrtbono nrtbnoo nrtbnoo nrtobon nrtobno nrtoobn nrtoonb nrtonob nrtonbo nrtoobn nrtoonb
nrtobon nrtobno nrtonbo nrtonob nrtnoob nrtnobo nrtnoob nrtnobo nrtnboo nrtnboo nrobton
nrobtno nrobotn nrobont nrobnot nrobnto nrotbon nrotbno nrotobn nrotonb nrotnob nrotnbo
nrootbn nrootnb nroobtn nroobnt nroonbt nroontb nrontob nrontbo nronotb nronobt nronbot
nronbto nrnbtoo nrnbtoo nrnboto nrnboot nrnboot nrnboto nrntboo nrntboo nrntobo nrntoob
nrntoob nrntobo nrnotbo nrnotob nrnobto nrnobot nrnoobt nrnootb nrnotob nrnotbo nrnootb
nrnoobt nrnobot nrnobto norbton norbtno norbotn norbont norbnot norbnto nortbon nortbno
nortobn nortonb nortnob nortnbo norotbn norotnb norobtn norobnt noronbt norontb norntob
norntbo nornotb nornobt nornbot nornbto nobrton nobrtno nobrotn nobront nobrnot nobrnto
nobtron nobtrno nobtorn nobtonr nobtnor nobtnro nobotrn nobotnr nobortn nobornt nobonrt
nobontr nobntor nobntro nobnotr nobnort nobnrot nobnrto notbron notbrno notborn notbonr
notbnor notbnro notrbon notrbno notrobn notronb notrnob notrnbo notorbn notornb notobrn
notobnr notonbr notonrb notnrob notnrbo notnorb notnobr notnbor notnbro noobtrn noobtnr
noobrtn noobrnt noobnrt noobntr nootbrn nootbnr nootrbn nootrnb nootnrb nootnbr noortbn
noortnb noorbtn noorbnt noornbt noorntb noontrb noontbr noonrtb noonrbt noonbrt noonbtr
nonbtor nonbtro nonbotr nonbort nonbrot nonbrto nontbor nontbro nontobr nontorb nontrob
nontrbo nonotbr nonotrb nonobtr nonobrt nonorbt nonortb nonrtob nonrtbo nonrotb nonrobt
nonrbot nonrbto nborton nbortno nborotn nboront nbornot nbornto nbotron nbotrno nbotorn
nbotonr nbotnor nbotnro nbootrn nbootnr nboortn nboornt nboonrt nboontr nbontor nbontro
nbonotr nbonort nbonrot nbonrto nbroton nbrotno nbrootn nbroont nbronot nbronto nbrtoon
nbrtono nbrtoon nbrtono nbrtnoo nbrtnoo nbroton nbrotno nbrootn nbroont nbronot nbronto
nbrntoo nbrntoo nbrnoto nbrnoot nbrnoot nbrnoto nbtroon nbtrono nbtroon nbtrono nbtrnoo
nbtrnoo nbtoron nbtorno nbtoorn nbtoonr nbtonor nbtonro nbtoorn nbtoonr nbtoron nbtorno
nbtonro nbtonor nbtnoor nbtnoro nbtnoor nbtnoro nbtnroo nbtnroo nborton nbortno nborotn
nboront nbornot nbornto nbotron nbotrno nbotorn nbotonr nbotnor nbotnro nbootrn nbootnr
nboortn nboornt nboonrt nboontr nbontor nbontro nbonotr nbonort nbonrot nbonrto nbnrtoo
nbnrtoo nbnroto nbnroot nbnroot nbnroto nbntroo nbntroo nbntoro nbntoor nbntoor nbntoro
nbnotro nbnotor nbnorto nbnorot nbnoort nbnootr nbnotor nbnotro nbnootr nbnoort nbnorot
nbnorto ntobron ntobrno ntoborn ntobonr ntobnor ntobnro ntorbon ntorbno ntorobn ntoronb
ntornob ntornbo ntoorbn ntoornb ntoobrn ntoobnr ntoonbr ntoonrb ntonrob ntonrbo ntonorb
ntonobr ntonbor ntonbro ntboron ntborno ntboorn ntboonr ntbonor ntbonro ntbroon ntbrono
ntbroon ntbrono ntbrnoo ntbrnoo ntboron ntborno ntboorn ntboonr ntbonor ntbonro ntbnroo
ntbnroo ntbnoro ntbnoor ntbnoor ntbnoro ntrboon ntrbono ntrboon ntrbono ntrbnoo ntrbnoo
ntrobon ntrobno ntroobn ntroonb ntronob ntronbo ntroobn ntroonb ntrobon ntrobno ntronbo
ntronob ntrnoob ntrnobo ntrnoob ntrnobo ntrnboo ntrnboo ntobron ntobrno ntoborn ntobonr
ntobnor ntobnro ntorbon ntorbno ntorobn ntoronb ntornob ntornbo ntoorbn ntoornb ntoobrn
ntoobnr ntoonbr ntoonrb ntonrob ntonrbo ntonorb ntonobr ntonbor ntonbro ntnbroo ntnbroo
ntnboro ntnboor ntnboor ntnboro ntnrboo ntnrboo ntnrobo ntnroob ntnroob ntnrobo ntnorbo
ntnorob ntnobro ntnobor ntnoobr ntnoorb ntnorob ntnorbo ntnoorb ntnoobr ntnobor ntnobro
noobtrn noobtnr noobrtn noobrnt noobnrt noobntr nootbrn nootbnr nootrbn nootrnb nootnrb
nootnbr noortbn noortnb noorbtn noorbnt noornbt noorntb noontrb noontbr noonrtb noonrbt
noonbrt noonbtr nobotrn nobotnr nobortn nobornt nobonrt nobontr nobtorn nobtonr nobtron
nobtrno nobtnro nobtnor nobrton nobrtno nobrotn nobront nobrnot nobrnto nobntro nobntor
nobnrto nobnrot nobnort nobnotr notborn notbonr notbron notbrno notbnro notbnor notobrn
notobnr notorbn notornb notonrb notonbr notrobn notronb notrbon notrbno notrnbo notrnob
notnorb notnobr notnrob notnrbo notnbro notnbor norbton norbtno norbotn norbont norbnot
norbnto nortbon nortbno nortobn nortonb nortnob nortnbo norotbn norotnb norobtn norobnt
noronbt norontb norntob norntbo nornotb nornobt nornbot nornbto nonbtro nonbtor nonbrto
nonbrot nonbort nonbotr nontbro nontbor nontrbo nontrob nontorb nontobr nonrtbo nonrtob
nonrbto nonrbot nonrobt nonrotb nonotrb nonotbr nonortb nonorbt nonobrt nonobtr nnobtor
nnobtro nnobotr nnobort nnobrot nnobrto nnotbor nnotbro nnotobr nnotorb nnotrob nnotrbo
nnootbr nnootrb nnoobtr nnoobrt nnoorbt nnoortb nnortob nnortbo nnorotb nnorobt nnorbot
nnorbto nnbotor nnbotro nnbootr nnboort nnborot nnborto nnbtoor nnbtoro nnbtoor nnbtoro
nnbtroo nnbtroo nnbotor nnbotro nnbootr nnboort nnborot nnborto nnbrtoo nnbrtoo nnbroto
nnbroot nnbroot nnbroto nntboor nntboro nntboor nntboro nntbroo nntbroo nntobor nntobro
nntoobr nntoorb nntorob nntorbo nntoobr nntoorb nntobor nntobro nntorbo nntorob nntroob
nntrobo nntroob nntrobo nntrboo nntrboo nnobtor nnobtro nnobotr nnobort nnobrot nnobrto
nnotbor nnotbro nnotobr nnotorb nnotrob nnotrbo nnootbr nnootrb nnoobtr nnoobrt nnoorbt
nnoortb nnortob nnortbo nnorotb nnorobt nnorbot nnorbto nnrbtoo nnrbtoo nnrboto nnrboot
nnrboot nnrboto nnrtboo nnrtboo nnrtobo nnrtoob nnrtoob nnrtobo nnrotbo nnrotob nnrobto
nnrobot nnroobt nnrootb nnrotob nnrotbo nnrootb nnroobt nnrobot nnrobto tronbon tronbno
tronobn trononb tronnob tronnbo trobnon trobnno trobonn trobonn trobnon trobnno troobnn
troobnn troonbn troonnb troonnb troonbn tronbon tronbno tronobn trononb tronnob tronnbo
trnobon trnobno trnoobn trnoonb trnonob trnonbo trnboon trnbono trnboon trnbono trnbnoo
trnbnoo trnobon trnobno trnoobn trnoonb trnonob trnonbo trnnboo trnnboo trnnobo trnnoob
trnnoob trnnobo trbnoon trbnono trbnoon trbnono trbnnoo trbnnoo trbonon trbonno trboonn
trboonn trbonon trbonno trboonn trboonn trbonon trbonno trbonno trbonon trbnoon trbnono
trbnoon trbnono trbnnoo trbnnoo tronbon tronbno tronobn trononb tronnob tronnbo trobnon
trobnno trobonn trobonn trobnon trobnno troobnn troobnn troonbn troonnb troonnb troonbn
tronbon tronbno tronobn trononb tronnob tronnbo trnnboo trnnboo trnnobo trnnoob trnnoob
trnnobo trnbnoo trnbnoo trnbono trnboon trnboon trnbono trnobno trnobon trnonbo trnonob
trnoonb trnoobn trnobon trnobno trnoobn trnoonb trnonob trnonbo tornbon tornbno tornobn
tornonb tornnob tornnbo torbnon torbnno torbonn torbonn torbnon torbnno torobnn torobnn
toronbn toronnb toronnb toronbn tornbon tornbno tornobn tornonb tornnob tornnbo tonrbon
tonrbno tonrobn tonronb tonrnob tonrnbo tonbron tonbrno tonborn tonbonr tonbnor tonbnro
tonobrn tonobnr tonorbn tonornb tononrb tononbr tonnbor tonnbro tonnobr tonnorb tonnrob
tonnrbo tobnron tobnrno tobnorn tobnonr tobnnor tobnnro tobrnon tobrnno tobronn tobronn
tobrnon tobrnno tobornn tobornn tobonrn tobonnr tobonnr tobonrn tobnron tobnrno tobnorn
tobnonr tobnnor tobnnro toonbrn toonbnr toonrbn toonrnb toonnrb toonnbr toobnrn toobnnr
toobrnn toobrnn toobnrn toobnnr toorbnn toorbnn toornbn toornnb toornnb toornbn toonbrn
toonbnr toonrbn toonrnb toonnrb toonnbr tonnbor tonnbro tonnobr tonnorb tonnrob tonnrbo
tonbnor tonbnro tonbonr tonborn tonbron tonbrno tonobnr tonobrn tononbr tononrb tonornb
tonorbn tonrbon tonrbno tonrobn tonronb tonrnob tonrnbo tnorbon tnorbno tnorobn tnoronb
tnornob tnornbo tnobron tnobrno tnoborn tnobonr tnobnor tnobnro tnoobrn tnoobnr tnoorbn
tnoornb tnoonrb tnoonbr tnonbor tnonbro tnonobr tnonorb tnonrob tnonrbo tnrobon tnrobno
tnroobn tnroonb tnronob tnronbo tnrboon tnrbono tnrboon tnrbono tnrbnoo tnrbnoo tnrobon
tnrobno tnroobn tnroonb tnronob tnronbo tnrnboo tnrnboo tnrnobo tnrnoob tnrnoob tnrnobo
tnbroon tnbrono tnbroon tnbrono tnbrnoo tnbrnoo tnboron tnborno tnboorn tnboonr tnbonor
tnbonro tnboorn tnboonr tnboron tnborno tnbonro tnbonor tnbnoor tnbnoro tnbnoor tnbnoro
tnbnroo tnbnroo tnorbon tnorbno tnorobn tnoronb tnornob tnornbo tnobron tnobrno tnoborn
tnobonr tnobnor tnobnro tnoobrn tnoobnr tnoorbn tnoornb tnoonrb tnoonbr tnonbor tnonbro
tnonobr tnonorb tnonrob tnonrbo tnnrboo tnnrboo tnnrobo tnnroob tnnroob tnnrobo tnnbroo
tnnbroo tnnboro tnnboor tnnboor tnnboro tnnobro tnnobor tnnorbo tnnorob tnnoorb tnnoobr
tnnobor tnnobro tnnoobr tnnoorb tnnorob tnnorbo tbonron tbonrno tbonorn tbononr tbonnor
tbonnro tbornon tbornno tboronn tboronn tbornon tbornno tboornn tboornn tboonrn tboonnr
tboonnr tboonrn tbonron tbonrno tbonorn tbononr tbonnor tbonnro tbnoron tbnorno tbnoorn
tbnoonr tbnonor tbnonro tbnroon tbnrono tbnroon tbnrono tbnrnoo tbnrnoo tbnoron tbnorno
tbnoorn tbnoonr tbnonor tbnonro tbnnroo tbnnroo tbnnoro tbnnoor tbnnoor tbnnoro tbrnoon
tbrnono tbrnoon tbrnono tbrnnoo tbrnnoo tbronon tbronno tbroonn tbroonn tbronon tbronno
tbroonn tbroonn tbronon tbronno tbronno tbronon tbrnoon tbrnono tbrnoon tbrnono tbrnnoo
tbrnnoo tbonron tbonrno tbonorn tbononr tbonnor tbonnro tbornon tbornno tboronn tboronn
tbornon tbornno tboornn tboornn tboonrn tboonnr tboonnr tboonrn tbonron tbonrno tbonorn
tbononr tbonnor tbonnro tbnnroo tbnnroo tbnnoro tbnnoor tbnnoor tbnnoro tbnrnoo tbnrnoo
tbnrono tbnroon tbnroon tbnrono tbnorno tbnoron tbnonro tbnonor tbnoonr tbnoorn tbnoron
tbnorno tbnoorn tbnoonr tbnonor tbnonro toonbrn toonbnr toonrbn toonrnb toonnrb toonnbr
toobnrn toobnnr toobrnn toobrnn toobnrn toobnnr toorbnn toorbnn toornbn toornnb toornnb
toornbn toonbrn toonbnr toonrbn toonrnb toonnrb toonnbr tonobrn tonobnr tonorbn tonornb
tononrb tononbr tonborn tonbonr tonbron tonbrno tonbnro tonbnor tonrbon tonrbno tonrobn
tonronb tonrnob tonrnbo tonnbro tonnbor tonnrbo tonnrob tonnorb tonnobr tobnorn tobnonr
tobnron tobnrno tobnnro tobnnor tobonrn tobonnr tobornn tobornn tobonrn tobonnr tobronn
tobronn tobrnon tobrnno tobrnno tobrnon tobnorn tobnonr tobnron tobnrno tobnnro tobnnor
tornbon tornbno tornobn tornonb tornnob tornnbo torbnon torbnno torbonn torbonn torbnon
torbnno torobnn torobnn toronbn toronnb toronnb toronbn tornbon tornbno tornobn tornonb
tornnob tornnbo tonnbro tonnbor tonnrbo tonnrob tonnorb tonnobr tonbnro tonbnor tonbrno
tonbron tonborn tonbonr tonrbno tonrbon tonrnbo tonrnob tonronb tonrobn tonobrn tonobnr
tonorbn tonornb tononrb tononbr tnonbor tnonbro tnonobr tnonorb tnonrob tnonrbo tnobnor
tnobnro tnobonr tnoborn tnobron tnobrno tnoobnr tnoobrn tnoonbr tnoonrb tnoornb tnoorbn
tnorbon tnorbno tnorobn tnoronb tnornob tnornbo tnnobor tnnobro tnnoobr tnnoorb tnnorob
tnnorbo tnnboor tnnboro tnnboor tnnboro tnnbroo tnnbroo tnnobor tnnobro tnnoobr tnnoorb
tnnorob tnnorbo tnnrboo tnnrboo tnnrobo tnnroob tnnroob tnnrobo tnbnoor tnbnoro tnbnoor
tnbnoro tnbnroo tnbnroo tnbonor tnbonro tnboonr tnboorn tnboron tnborno tnboonr tnboorn
tnbonor tnbonro tnborno tnboron tnbroon tnbrono tnbroon tnbrono tnbrnoo tnbrnoo tnonbor
tnonbro tnonobr tnonorb tnonrob tnonrbo tnobnor tnobnro tnobonr tnoborn tnobron tnobrno
tnoobnr tnoobrn tnoonbr tnoonrb tnoornb tnoorbn tnorbon tnorbno tnorobn tnoronb tnornob
tnornbo tnrnboo tnrnboo tnrnobo tnrnoob tnrnoob tnrnobo tnrbnoo tnrbnoo tnrbono tnrboon
tnrboon tnrbono tnrobno tnrobon tnronbo tnronob tnroonb tnroobn tnrobon tnrobno tnroobn
tnroonb tnronob tnronbo orontbn orontnb oronbtn oronbnt oronnbt oronntb orotnbn orotnnb
orotbnn orotbnn orotnbn orotnnb orobtnn orobtnn orobntn orobnnt orobnnt orobntn orontbn
orontnb oronbtn oronbnt oronnbt oronntb ornotbn ornotnb ornobtn ornobnt ornonbt ornontb
orntobn orntonb orntbon orntbno orntnbo orntnob ornbton ornbtno ornbotn ornbont ornbnot
ornbnto ornntbo ornntob ornnbto ornnbot ornnobt ornnotb ortnobn ortnonb ortnbon ortnbno
ortnnbo ortnnob ortonbn ortonnb ortobnn ortobnn ortonbn ortonnb ortbonn ortbonn ortbnon
ortbnno ortbnno ortbnon ortnobn ortnonb ortnbon ortnbno ortnnbo ortnnob orbnton orbntno
orbnotn orbnont orbnnot orbnnto orbtnon orbtnno orbtonn orbtonn orbtnon orbtnno orbotnn
orbotnn orbontn orbonnt orbonnt orbontn orbnton orbntno orbnotn orbnont orbnnot orbnnto
ornntbo ornntob ornnbto ornnbot ornnobt ornnotb orntnbo orntnob orntbno orntbon orntobn
orntonb ornbtno ornbton ornbnto ornbnot ornbont ornbotn ornotbn ornotnb ornobtn ornobnt
ornonbt ornontb oorntbn oorntnb oornbtn oornbnt oornnbt oornntb oortnbn oortnnb oortbnn
oortbnn oortnbn oortnnb oorbtnn oorbtnn oorbntn oorbnnt oorbnnt oorbntn oorntbn oorntnb
oornbtn oornbnt oornnbt oornntb oonrtbn oonrtnb oonrbtn oonrbnt oonrnbt oonrntb oontrbn
oontrnb oontbrn oontbnr oontnbr oontnrb oonbtrn oonbtnr oonbrtn oonbrnt oonbnrt oonbntr
oonntbr oonntrb oonnbtr oonnbrt oonnrbt oonnrtb ootnrbn ootnrnb ootnbrn ootnbnr ootnnbr
ootnnrb ootrnbn ootrnnb ootrbnn ootrbnn ootrnbn ootrnnb ootbrnn ootbrnn ootbnrn ootbnnr
ootbnnr ootbnrn ootnrbn ootnrnb ootnbrn ootnbnr ootnnbr ootnnrb oobntrn oobntnr oobnrtn
oobnrnt oobnnrt oobnntr oobtnrn oobtnnr oobtrnn oobtrnn oobtnrn oobtnnr oobrtnn oobrtnn
oobrntn oobrnnt oobrnnt oobrntn oobntrn oobntnr oobnrtn oobnrnt oobnnrt oobnntr oonntbr
oonntrb oonnbtr oonnbrt oonnrbt oonnrtb oontnbr oontnrb oontbnr oontbrn oontrbn oontrnb
oonbtnr oonbtrn oonbntr oonbnrt oonbrnt oonbrtn oonrtbn oonrtnb oonrbtn oonrbnt oonrnbt
oonrntb onortbn onortnb onorbtn onorbnt onornbt onorntb onotrbn onotrnb onotbrn onotbnr
onotnbr onotnrb onobtrn onobtnr onobrtn onobrnt onobnrt onobntr onontbr onontrb ononbtr
ononbrt ononrbt ononrtb onrotbn onrotnb onrobtn onrobnt onronbt onrontb onrtobn onrtonb
onrtbon onrtbno onrtnbo onrtnob onrbton onrbtno onrbotn onrbont onrbnot onrbnto onrntbo
onrntob onrnbto onrnbot onrnobt onrnotb ontrobn ontronb ontrbon ontrbno ontrnbo ontrnob
ontorbn ontornb ontobrn ontobnr ontonbr ontonrb ontborn ontbonr ontbron ontbrno ontbnro
ontbnor ontnobr ontnorb ontnbor ontnbro ontnrbo ontnrob onbrton onbrtno onbrotn onbront
onbrnot onbrnto onbtron onbtrno onbtorn onbtonr onbtnor onbtnro onbotrn onbotnr onbortn
onbornt onbonrt onbontr onbntor onbntro onbnotr onbnort onbnrot onbnrto onnrtbo onnrtob
onnrbto onnrbot onnrobt onnrotb onntrbo onntrob onntbro onntbor onntobr onntorb onnbtro
onnbtor onnbrto onnbrot onnbort onnbotr onnotbr onnotrb onnobtr onnobrt onnorbt onnortb
otonrbn otonrnb otonbrn otonbnr otonnbr otonnrb otornbn otornnb otorbnn otorbnn otornbn
otornnb otobrnn otobrnn otobnrn otobnnr otobnnr otobnrn otonrbn otonrnb otonbrn otonbnr
otonnbr otonnrb otnorbn otnornb otnobrn otnobnr otnonbr otnonrb otnrobn otnronb otnrbon
otnrbno otnrnbo otnrnob otnbron otnbrno otnborn otnbonr otnbnor otnbnro otnnrbo otnnrob
otnnbro otnnbor otnnobr otnnorb otrnobn otrnonb otrnbon otrnbno otrnnbo otrnnob otronbn
otronnb otrobnn otrobnn otronbn otronnb otrbonn otrbonn otrbnon otrbnno otrbnno otrbnon
otrnobn otrnonb otrnbon otrnbno otrnnbo otrnnob otbnron otbnrno otbnorn otbnonr otbnnor
otbnnro otbrnon otbrnno otbronn otbronn otbrnon otbrnno otbornn otbornn otbonrn otbonnr
otbonnr otbonrn otbnron otbnrno otbnorn otbnonr otbnnor otbnnro otnnrbo otnnrob otnnbro
otnnbor otnnobr otnnorb otnrnbo otnrnob otnrbno otnrbon otnrobn otnronb otnbrno otnbron
otnbnro otnbnor otnbonr otnborn otnorbn otnornb otnobrn otnobnr otnonbr otnonrb obontrn
obontnr obonrtn obonrnt obonnrt obonntr obotnrn obotnnr obotrnn obotrnn obotnrn obotnnr
obortnn obortnn oborntn obornnt obornnt oborntn obontrn obontnr obonrtn obonrnt obonnrt
obonntr obnotrn obnotnr obnortn obnornt obnonrt obnontr obntorn obntonr obntron obntrno
obntnro obntnor obnrton obnrtno obnrotn obnront obnrnot obnrnto obnntro obnntor obnnrto
obnnrot obnnort obnnotr obtnorn obtnonr obtnron obtnrno obtnnro obtnnor obtonrn obtonnr
obtornn obtornn obtonrn obtonnr obtronn obtronn obtrnon obtrnno obtrnno obtrnon obtnorn
obtnonr obtnron obtnrno obtnnro obtnnor obrnton obrntno obrnotn obrnont obrnnot obrnnto
obrtnon obrtnno obrtonn obrtonn obrtnon obrtnno obrotnn obrotnn obrontn obronnt obronnt
obrontn obrnton obrntno obrnotn obrnont obrnnot obrnnto obnntro obnntor obnnrto obnnrot
obnnort obnnotr obntnro obntnor obntrno obntron obntorn obntonr obnrtno obnrton obnrnto
obnrnot obnront obnrotn obnotrn obnotnr obnortn obnornt obnonrt obnontr onontbr onontrb
ononbtr ononbrt ononrbt ononrtb onotnbr onotnrb onotbnr onotbrn onotrbn onotrnb onobtnr
onobtrn onobntr onobnrt onobrnt onobrtn onortbn onortnb onorbtn onorbnt onornbt onorntb
onnotbr onnotrb onnobtr onnobrt onnorbt onnortb onntobr onntorb onntbor onntbro onntrbo
onntrob onnbtor onnbtro onnbotr onnbort onnbrot onnbrto onnrtbo onnrtob onnrbto onnrbot
onnrobt onnrotb ontnobr ontnorb ontnbor ontnbro ontnrbo ontnrob ontonbr ontonrb ontobnr
ontobrn ontorbn ontornb ontbonr ontborn ontbnor ontbnro ontbrno ontbron ontrobn ontronb
ontrbon ontrbno ontrnbo ontrnob onbntor onbntro onbnotr onbnort onbnrot onbnrto onbtnor
onbtnro onbtonr onbtorn onbtron onbtrno onbotnr onbotrn onbontr onbonrt onbornt onbortn
onbrton onbrtno onbrotn onbront onbrnot onbrnto onrntbo onrntob onrnbto onrnbot onrnobt
onrnotb onrtnbo onrtnob onrtbno onrtbon onrtobn onrtonb onrbtno onrbton onrbnto onrbnot
onrbont onrbotn onrotbn onrotnb onrobtn onrobnt onronbt onrontb nrontob nrontbo nronotb
nronobt nronbot nronbto nrotnob nrotnbo nrotonb nrotobn nrotbon nrotbno nrootnb nrootbn
nroontb nroonbt nroobnt nroobtn nrobton nrobtno nrobotn nrobont nrobnot nrobnto nrnotob
nrnotbo nrnootb nrnoobt nrnobot nrnobto nrntoob nrntobo nrntoob nrntobo nrntboo nrntboo
nrnotob nrnotbo nrnootb nrnoobt nrnobot nrnobto nrnbtoo nrnbtoo nrnboto nrnboot nrnboot
nrnboto nrtnoob nrtnobo nrtnoob nrtnobo nrtnboo nrtnboo nrtonob nrtonbo nrtoonb nrtoobn
nrtobon nrtobno nrtoonb nrtoobn nrtonob nrtonbo nrtobno nrtobon nrtboon nrtbono nrtboon
nrtbono nrtbnoo nrtbnoo nrontob nrontbo nronotb nronobt nronbot nronbto nrotnob nrotnbo
nrotonb nrotobn nrotbon nrotbno nrootnb nrootbn nroontb nroonbt nroobnt nroobtn nrobton
nrobtno nrobotn nrobont nrobnot nrobnto nrbntoo nrbntoo nrbnoto nrbnoot nrbnoot nrbnoto
nrbtnoo nrbtnoo nrbtono nrbtoon nrbtoon nrbtono nrbotno nrboton nrbonto nrbonot nrboont
nrbootn nrboton nrbotno nrbootn nrboont nrbonot nrbonto norntob norntbo nornotb nornobt
nornbot nornbto nortnob nortnbo nortonb nortobn nortbon nortbno norotnb norotbn norontb
noronbt norobnt norobtn norbton norbtno norbotn norbont norbnot norbnto nonrtob nonrtbo
nonrotb nonrobt nonrbot nonrbto nontrob nontrbo nontorb nontobr nontbor nontbro nonotrb
nonotbr nonortb nonorbt nonobrt nonobtr nonbtor nonbtro nonbotr nonbort nonbrot nonbrto
notnrob notnrbo notnorb notnobr notnbor notnbro notrnob notrnbo notronb notrobn notrbon
notrbno notornb notorbn notonrb notonbr notobnr notobrn notbron notbrno notborn notbonr
notbnor notbnro noontrb noontbr noonrtb noonrbt noonbrt noonbtr nootnrb nootnbr nootrnb
nootrbn nootbrn nootbnr noortnb noortbn noorntb noornbt noorbnt noorbtn noobtrn noobtnr
noobrtn noobrnt noobnrt noobntr nobntor nobntro nobnotr nobnort nobnrot nobnrto nobtnor
nobtnro nobtonr nobtorn nobtron nobtrno nobotnr nobotrn nobontr nobonrt nobornt nobortn
nobrton nobrtno nobrotn nobront nobrnot nobrnto nnortob nnortbo nnorotb nnorobt nnorbot
nnorbto nnotrob nnotrbo nnotorb nnotobr nnotbor nnotbro nnootrb nnootbr nnoortb nnoorbt
nnoobrt nnoobtr nnobtor nnobtro nnobotr nnobort nnobrot nnobrto nnrotob nnrotbo nnrootb
nnroobt nnrobot nnrobto nnrtoob nnrtobo nnrtoob nnrtobo nnrtboo nnrtboo nnrotob nnrotbo
nnrootb nnroobt nnrobot nnrobto nnrbtoo nnrbtoo nnrboto nnrboot nnrboot nnrboto nntroob
nntrobo nntroob nntrobo nntrboo nntrboo nntorob nntorbo nntoorb nntoobr nntobor nntobro
nntoorb nntoobr nntorob nntorbo nntobro nntobor nntboor nntboro nntboor nntboro nntbroo
nntbroo nnortob nnortbo nnorotb nnorobt nnorbot nnorbto nnotrob nnotrbo nnotorb nnotobr
nnotbor nnotbro nnootrb nnootbr nnoortb nnoorbt nnoobrt nnoobtr nnobtor nnobtro nnobotr
nnobort nnobrot nnobrto nnbrtoo nnbrtoo nnbroto nnbroot nnbroot nnbroto nnbtroo nnbtroo
nnbtoro nnbtoor nnbtoor nnbtoro nnbotro nnbotor nnborto nnborot nnboort nnbootr nnbotor
nnbotro nnbootr nnboort nnborot nnborto ntonrob ntonrbo ntonorb ntonobr ntonbor ntonbro
ntornob ntornbo ntoronb ntorobn ntorbon ntorbno ntoornb ntoorbn ntoonrb ntoonbr ntoobnr
ntoobrn ntobron ntobrno ntoborn ntobonr ntobnor ntobnro ntnorob ntnorbo ntnoorb ntnoobr
ntnobor ntnobro ntnroob ntnrobo ntnroob ntnrobo ntnrboo ntnrboo ntnorob ntnorbo ntnoorb
ntnoobr ntnobor ntnobro ntnbroo ntnbroo ntnboro ntnboor ntnboor ntnboro ntrnoob ntrnobo
ntrnoob ntrnobo ntrnboo ntrnboo ntronob ntronbo ntroonb ntroobn ntrobon ntrobno ntroonb
ntroobn ntronob ntronbo ntrobno ntrobon ntrboon ntrbono ntrboon ntrbono ntrbnoo ntrbnoo
ntonrob ntonrbo ntonorb ntonobr ntonbor ntonbro ntornob ntornbo ntoronb ntorobn ntorbon
ntorbno ntoornb ntoorbn ntoonrb ntoonbr ntoobnr ntoobrn ntobron ntobrno ntoborn ntobonr
ntobnor ntobnro ntbnroo ntbnroo ntbnoro ntbnoor ntbnoor ntbnoro ntbrnoo ntbrnoo ntbrono
ntbroon ntbroon ntbrono ntborno ntboron ntbonro ntbonor ntboonr ntboorn ntboron ntborno
ntboorn ntboonr ntbonor ntbonro noontrb noontbr noonrtb noonrbt noonbrt noonbtr nootnrb
nootnbr nootrnb nootrbn nootbrn nootbnr noortnb noortbn noorntb noornbt noorbnt noorbtn
noobtrn noobtnr noobrtn noobrnt noobnrt noobntr nonotrb nonotbr nonortb nonorbt nonobrt
nonobtr nontorb nontobr nontrob nontrbo nontbro nontbor nonrtob nonrtbo nonrotb nonrobt
nonrbot nonrbto nonbtro nonbtor nonbrto nonbrot nonbort nonbotr notnorb notnobr notnrob
notnrbo notnbro notnbor notonrb notonbr notornb notorbn notobrn notobnr notronb notrobn
notrnob notrnbo notrbno notrbon notborn notbonr notbron notbrno notbnro notbnor norntob
norntbo nornotb nornobt nornbot nornbto nortnob nortnbo nortonb nortobn nortbon nortbno
norotnb norotbn norontb noronbt norobnt norobtn norbton norbtno norbotn norbont norbnot
norbnto nobntro nobntor nobnrto nobnrot nobnort nobnotr nobtnro nobtnor nobtrno nobtron
nobtorn nobtonr nobrtno nobrton nobrnto nobrnot nobront nobrotn nobotrn nobotnr nobortn
nobornt nobonrt nobontr nbontor nbontro nbonotr nbonort nbonrot nbonrto nbotnor nbotnro
nbotonr nbotorn nbotron nbotrno nbootnr nbootrn nboontr nboonrt nboornt nboortn nborton
nbortno nborotn nboront nbornot nbornto nbnotor nbnotro nbnootr nbnoort nbnorot nbnorto
nbntoor nbntoro nbntoor nbntoro nbntroo nbntroo nbnotor nbnotro nbnootr nbnoort nbnorot
nbnorto nbnrtoo nbnrtoo nbnroto nbnroot nbnroot nbnroto nbtnoor nbtnoro nbtnoor nbtnoro
nbtnroo nbtnroo nbtonor nbtonro nbtoonr nbtoorn nbtoron nbtorno nbtoonr nbtoorn nbtonor
nbtonro nbtorno nbtoron nbtroon nbtrono nbtroon nbtrono nbtrnoo nbtrnoo nbontor nbontro
nbonotr nbonort nbonrot nbonrto nbotnor nbotnro nbotonr nbotorn nbotron nbotrno nbootnr
nbootrn nboontr nboonrt nboornt nboortn nborton nbortno nborotn nboront nbornot nbornto
nbrntoo nbrntoo nbrnoto nbrnoot nbrnoot nbrnoto nbrtnoo nbrtnoo nbrtono nbrtoon nbrtoon
nbrtono nbrotno nbroton nbronto nbronot nbroont nbrootn nbroton nbrotno nbrootn nbroont
nbronot nbronto

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us