easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

anstey

vergi

satinfin

calory

usurpamini

portabis

inexecutable

estonia

pasceritisque

ovatoacuminate

armipotentumque

glore

primogenitive

unhumbly

sawsan

muraena

placewoman

unprotruded


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: blotched
cipher variations:
cmpudife dnqvejgf eorwfkhg fpsxglih gqtyhmji
hruzinkj isvajolk jtwbkpml kuxclqnm lvydmron
mwzenspo nxafotqp oybgpurq pzchqvsr qadirwts
rbejsxut scfktyvu tdgluzwv uehmvaxw vfinwbyx
wgjoxczy xhkpydaz yilqzeba zjmrafcb aknsbgdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: blotched
Cipher: yolgxsvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: blotched
Cipher: AAAAB ABABA ABBAB BAABA AAABA AABBB AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: blotched
cipher variations:
cmpudifeeirghwnkgetslkvqiavepydwkwxqtmlcmszcxatiqkdafcjusgfmjqra
uchynezgwyjkrshmyulwvgpsaqnizuxydnqvejgffjshixolhfutmlwrjbwfqzex
lxyrunmdntadybujrlebgdkvthgnkrsbvdizofahxzklstinzvmxwhqtbrojavyz
eorwfkhggktijypmigvunmxskcxgrafymyzsvoneoubezcvksmfchelwuiholstc
wejapgbiyalmtujoawnyxirucspkbwzafpsxglihhlujkzqnjhwvonytldyhsbgz
nzatwpofpvcfadwltngdifmxvjipmtudxfkbqhcjzbmnuvkpbxozyjsvdtqlcxab
gqtyhmjiimvklarokixwpozumezitchaoabuxqpgqwdgbexmuohejgnywkjqnuve
yglcridkacnovwlqcypazktweurmdybchruzinkjjnwlmbspljyxqpavnfajudib
pbcvyrqhrxehcfynvpifkhozxlkrovwfzhmdsjelbdopwxmrdzqbaluxfvsnezcd
isvajolkkoxmnctqmkzyrqbwogbkvejcqcdwzsrisyfidgzowqjglipaymlspwxg
ainetkfmcepqxynsearcbmvygwtofadejtwbkpmllpynodurnlazsrcxphclwfkd
rdexatsjtzgjehapxrkhmjqbznmtqxyhbjofulgndfqryzotfbsdcnwzhxupgbef
kuxclqnmmqzopevsombatsdyqidmxglesefybutkuahkfibqyslinkrcaonuryzi
ckpgvmhoegrszapugctedoxaiyvqhcfglvydmronnrapqfwtpncbutezrjenyhmf
tfgzcvulvbilgjcrztmjolsdbpovszajdlqhwnipfhstabqvhdufepybjzwridgh
mwzenspoosbqrgxuqodcvufaskfozingughadwvmwcjmhkdsaunkpmtecqpwtabk
emrixojqgitubcrwievgfqzckaxsjehinxafotqpptcrshyvrpedwvgbtlgpajoh
vhibexwnxdkniletbvolqnufdrqxubclfnsjypkrhjuvcdsxjfwhgradlbytkfij
oybgpurqqudstizwsqfexwhcumhqbkpiwijcfyxoyelojmfucwpmrovgesryvcdm
gotkzqlsikvwdetykgxihsbemczulgjkpzchqvsrrvetujaxtrgfyxidvnirclqj
xjkdgzypzfmpkngvdxqnspwhftszwdenhpularmtjlwxefuzlhyjitcfndavmhkl
qadirwtsswfuvkbyushgzyjewojsdmrkyklehazqagnqlohweyrotqxigutaxefo
iqvmbsnukmxyfgvamizkjudgoebwnilmrbejsxuttxgvwlczvtihazkfxpktensl
zlmfibarbhormpixfzspuryjhvubyfgpjrwnctovlnyzghwbnjalkvehpfcxojmn
scfktyvuuyhwxmdawujibalgyqlufotmamngjcbscipsnqjygatqvszkiwvczghq
ksxodupwmozahixcokbmlwfiqgdypknotdgluzwvvzixynebxvkjcbmhzrmvgpun
bnohkdctdjqtorkzhburwtaljxwdahirltypevqxnpabijydplcnmxgjrhezqlop
uehmvaxwwajyzofcywlkdcniasnwhqvocopileduekrupslaicvsxubmkyxebijs
muzqfwryoqbcjkzeqmdonyhksifarmpqvfinwbyxxbkzapgdzxmledojbtoxirwp
dpqjmfevflsvqtmbjdwtyvcnlzyfcjktnvargxszprcdklafrnepoziltjgbsnqr
wgjoxczyyclabqheaynmfepkcupyjsxqeqrkngfwgmtwrunckexuzwdomazgdklu
owbshytaqsdelmbgsofqpajmukhctorsxhkpydazzdmbcrifbzongfqldvqzktyr
frslohgxhnuxsvodlfyvaxepnbahelmvpxctizubrtefmnchtpgrqbknvlidupst
yilqzebaaencdsjgcapohgrmewraluzsgstmpihyiovytwpemgzwbyfqocbifmnw
qydujavcsufgnodiuqhsrclowmjevqtuzjmrafcbbfodetkhdbqpihsnfxsbmvat
htunqjizjpwzuxqfnhaxczgrpdcjgnoxrzevkbwdtvghopejvritsdmpxnkfwruv
aknsbgdccgpefuliecrqjitogytcnwbuiuvorkjakqxavyrgoibydahsqedkhopy
safwlcxeuwhipqfkwsjutenqyolgxsvwblotcheddhqfgvmjfdsrkjuphzudoxcv
jvwpslkblrybwzshpjczebitrfelipqztbgxmdyfvxijqrglxtkvuforzpmhytwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: blotched
Cipher: oybgpurq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: blotched
Cipher: 2113434431325141

Extended Methods:
Method #1

Plaintext: blotched
method variations:
gqtyhnkimvydnsporadisxutwfioxczy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b l o t c h e d 
2 1 4 4 3 3 5 4 
1 3 3 4 1 2 1 1 
They are then read out in rows:
2144335413341211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: blotched
Cipher: btnulsfa

Read more ...
Method #3

Plaintext: blotched
method variations:
assolwqf ssolwqfa solwqfas
olwqfass lwqfasso wqfassol
qfassolw fassolwq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: blotched

first 5040 cipher variations(40320 total)
blotched blotchde blotcehd blotcedh blotcdeh blotcdhe blothced blothcde blothecd blothedc blothdec
blothdce blotehcd blotehdc blotechd blotecdh blotedch blotedhc blotdhec blotdhce blotdehc blotdech
blotdceh blotdche blocthed blocthde bloctehd bloctedh bloctdeh bloctdhe blochted blochtde blochetd
blochedt blochdet blochdte blocehtd blocehdt blocethd blocetdh blocedth blocedht blocdhet blocdhte
blocdeht blocdeth blocdteh blocdthe blohcted blohctde blohcetd blohcedt blohcdet blohcdte blohtced
blohtcde blohtecd blohtedc blohtdec blohtdce blohetcd blohetdc blohectd blohecdt blohedct blohedtc
blohdtec blohdtce blohdetc blohdect blohdcet blohdcte bloechtd bloechdt bloecthd bloectdh bloecdth
bloecdht bloehctd bloehcdt bloehtcd bloehtdc bloehdtc bloehdct bloethcd bloethdc bloetchd bloetcdh
bloetdch bloetdhc bloedhtc bloedhct bloedthc bloedtch bloedcth bloedcht blodchet blodchte blodceht
blodceth blodcteh blodcthe blodhcet blodhcte blodhect blodhetc blodhtec blodhtce blodehct blodehtc
blodecht blodecth blodetch blodethc blodthec blodthce blodtehc blodtech blodtceh blodtche bltoched
bltochde bltocehd bltocedh bltocdeh bltocdhe bltohced bltohcde bltohecd bltohedc bltohdec bltohdce
bltoehcd bltoehdc bltoechd bltoecdh bltoedch bltoedhc bltodhec bltodhce bltodehc bltodech bltodceh
bltodche bltcohed bltcohde bltcoehd bltcoedh bltcodeh bltcodhe bltchoed bltchode bltcheod bltchedo
bltchdeo bltchdoe bltcehod bltcehdo bltceohd bltceodh bltcedoh bltcedho bltcdheo bltcdhoe bltcdeho
bltcdeoh bltcdoeh bltcdohe blthcoed blthcode blthceod blthcedo blthcdeo blthcdoe blthoced blthocde
blthoecd blthoedc blthodec blthodce bltheocd bltheodc blthecod blthecdo blthedco blthedoc blthdoec
blthdoce blthdeoc blthdeco blthdceo blthdcoe bltechod bltechdo bltecohd bltecodh bltecdoh bltecdho
bltehcod bltehcdo bltehocd bltehodc bltehdoc bltehdco blteohcd blteohdc blteochd blteocdh blteodch
blteodhc bltedhoc bltedhco bltedohc bltedoch bltedcoh bltedcho bltdcheo bltdchoe bltdceho bltdceoh
bltdcoeh bltdcohe bltdhceo bltdhcoe bltdheco bltdheoc bltdhoec bltdhoce bltdehco bltdehoc bltdecho
bltdecoh bltdeoch bltdeohc bltdohec bltdohce bltdoehc bltdoech bltdoceh bltdoche blctohed blctohde
blctoehd blctoedh blctodeh blctodhe blcthoed blcthode blctheod blcthedo blcthdeo blcthdoe blctehod
blctehdo blcteohd blcteodh blctedoh blctedho blctdheo blctdhoe blctdeho blctdeoh blctdoeh blctdohe
blcothed blcothde blcotehd blcotedh blcotdeh blcotdhe blcohted blcohtde blcohetd blcohedt blcohdet
blcohdte blcoehtd blcoehdt blcoethd blcoetdh blcoedth blcoedht blcodhet blcodhte blcodeht blcodeth
blcodteh blcodthe blchoted blchotde blchoetd blchoedt blchodet blchodte blchtoed blchtode blchteod
blchtedo blchtdeo blchtdoe blchetod blchetdo blcheotd blcheodt blchedot blchedto blchdteo blchdtoe
blchdeto blchdeot blchdoet blchdote blceohtd blceohdt blceothd blceotdh blceodth blceodht blcehotd
blcehodt blcehtod blcehtdo blcehdto blcehdot blcethod blcethdo blcetohd blcetodh blcetdoh blcetdho
blcedhto blcedhot blcedtho blcedtoh blcedoth blcedoht blcdohet blcdohte blcdoeht blcdoeth blcdoteh
blcdothe blcdhoet blcdhote blcdheot blcdheto blcdhteo blcdhtoe blcdehot blcdehto blcdeoht blcdeoth
blcdetoh blcdetho blcdtheo blcdthoe blcdteho blcdteoh blcdtoeh blcdtohe blhtcoed blhtcode blhtceod
blhtcedo blhtcdeo blhtcdoe blhtoced blhtocde blhtoecd blhtoedc blhtodec blhtodce blhteocd blhteodc
blhtecod blhtecdo blhtedco blhtedoc blhtdoec blhtdoce blhtdeoc blhtdeco blhtdceo blhtdcoe blhctoed
blhctode blhcteod blhctedo blhctdeo blhctdoe blhcoted blhcotde blhcoetd blhcoedt blhcodet blhcodte
blhceotd blhceodt blhcetod blhcetdo blhcedto blhcedot blhcdoet blhcdote blhcdeot blhcdeto blhcdteo
blhcdtoe blhocted blhoctde blhocetd blhocedt blhocdet blhocdte blhotced blhotcde blhotecd blhotedc
blhotdec blhotdce blhoetcd blhoetdc blhoectd blhoecdt blhoedct blhoedtc blhodtec blhodtce blhodetc
blhodect blhodcet blhodcte blhecotd blhecodt blhectod blhectdo blhecdto blhecdot blheoctd blheocdt
blheotcd blheotdc blheodtc blheodct blhetocd blhetodc blhetcod blhetcdo blhetdco blhetdoc blhedotc
blhedoct blhedtoc blhedtco blhedcto blhedcot blhdcoet blhdcote blhdceot blhdceto blhdcteo blhdctoe
blhdocet blhdocte blhdoect blhdoetc blhdotec blhdotce blhdeoct blhdeotc blhdecot blhdecto blhdetco
blhdetoc blhdtoec blhdtoce blhdteoc blhdteco blhdtceo blhdtcoe bletchod bletchdo bletcohd bletcodh
bletcdoh bletcdho blethcod blethcdo blethocd blethodc blethdoc blethdco bletohcd bletohdc bletochd
bletocdh bletodch bletodhc bletdhoc bletdhco bletdohc bletdoch bletdcoh bletdcho blecthod blecthdo
blectohd blectodh blectdoh blectdho blechtod blechtdo blechotd blechodt blechdot blechdto blecohtd
blecohdt blecothd blecotdh blecodth blecodht blecdhot blecdhto blecdoht blecdoth blecdtoh blecdtho
blehctod blehctdo blehcotd blehcodt blehcdot blehcdto blehtcod blehtcdo blehtocd blehtodc blehtdoc
blehtdco blehotcd blehotdc blehoctd blehocdt blehodct blehodtc blehdtoc blehdtco blehdotc blehdoct
blehdcot blehdcto bleochtd bleochdt bleocthd bleoctdh bleocdth bleocdht bleohctd bleohcdt bleohtcd
bleohtdc bleohdtc bleohdct bleothcd bleothdc bleotchd bleotcdh bleotdch bleotdhc bleodhtc bleodhct
bleodthc bleodtch bleodcth bleodcht bledchot bledchto bledcoht bledcoth bledctoh bledctho bledhcot
bledhcto bledhoct bledhotc bledhtoc bledhtco bledohct bledohtc bledocht bledocth bledotch bledothc
bledthoc bledthco bledtohc bledtoch bledtcoh bledtcho bldtcheo bldtchoe bldtceho bldtceoh bldtcoeh
bldtcohe bldthceo bldthcoe bldtheco bldtheoc bldthoec bldthoce bldtehco bldtehoc bldtecho bldtecoh
bldteoch bldteohc bldtohec bldtohce bldtoehc bldtoech bldtoceh bldtoche bldctheo bldcthoe bldcteho
bldcteoh bldctoeh bldctohe bldchteo bldchtoe bldcheto bldcheot bldchoet bldchote bldcehto bldcehot
bldcetho bldcetoh bldceoth bldceoht bldcohet bldcohte bldcoeht bldcoeth bldcoteh bldcothe bldhcteo
bldhctoe bldhceto bldhceot bldhcoet bldhcote bldhtceo bldhtcoe bldhteco bldhteoc bldhtoec bldhtoce
bldhetco bldhetoc bldhecto bldhecot bldheoct bldheotc bldhotec bldhotce bldhoetc bldhoect bldhocet
bldhocte bldechto bldechot bldectho bldectoh bldecoth bldecoht bldehcto bldehcot bldehtco bldehtoc
bldehotc bldehoct bldethco bldethoc bldetcho bldetcoh bldetoch bldetohc bldeohtc bldeohct bldeothc
bldeotch bldeocth bldeocht bldochet bldochte bldoceht bldoceth bldocteh bldocthe bldohcet bldohcte
bldohect bldohetc bldohtec bldohtce bldoehct bldoehtc bldoecht bldoecth bldoetch bldoethc bldothec
bldothce bldotehc bldotech bldotceh bldotche boltched boltchde boltcehd boltcedh boltcdeh boltcdhe
bolthced bolthcde bolthecd bolthedc bolthdec bolthdce boltehcd boltehdc boltechd boltecdh boltedch
boltedhc boltdhec boltdhce boltdehc boltdech boltdceh boltdche bolcthed bolcthde bolctehd bolctedh
bolctdeh bolctdhe bolchted bolchtde bolchetd bolchedt bolchdet bolchdte bolcehtd bolcehdt bolcethd
bolcetdh bolcedth bolcedht bolcdhet bolcdhte bolcdeht bolcdeth bolcdteh bolcdthe bolhcted bolhctde
bolhcetd bolhcedt bolhcdet bolhcdte bolhtced bolhtcde bolhtecd bolhtedc bolhtdec bolhtdce bolhetcd
bolhetdc bolhectd bolhecdt bolhedct bolhedtc bolhdtec bolhdtce bolhdetc bolhdect bolhdcet bolhdcte
bolechtd bolechdt bolecthd bolectdh bolecdth bolecdht bolehctd bolehcdt bolehtcd bolehtdc bolehdtc
bolehdct bolethcd bolethdc boletchd boletcdh boletdch boletdhc boledhtc boledhct boledthc boledtch
boledcth boledcht boldchet boldchte boldceht boldceth boldcteh boldcthe boldhcet boldhcte boldhect
boldhetc boldhtec boldhtce boldehct boldehtc boldecht boldecth boldetch boldethc boldthec boldthce
boldtehc boldtech boldtceh boldtche botlched botlchde botlcehd botlcedh botlcdeh botlcdhe botlhced
botlhcde botlhecd botlhedc botlhdec botlhdce botlehcd botlehdc botlechd botlecdh botledch botledhc
botldhec botldhce botldehc botldech botldceh botldche botclhed botclhde botclehd botcledh botcldeh
botcldhe botchled botchlde botcheld botchedl botchdel botchdle botcehld botcehdl botcelhd botceldh
botcedlh botcedhl botcdhel botcdhle botcdehl botcdelh botcdleh botcdlhe bothcled bothclde bothceld
bothcedl bothcdel bothcdle bothlced bothlcde bothlecd bothledc bothldec bothldce bothelcd botheldc
bothecld bothecdl bothedcl bothedlc bothdlec bothdlce bothdelc bothdecl bothdcel bothdcle botechld
botechdl boteclhd botecldh botecdlh botecdhl botehcld botehcdl botehlcd botehldc botehdlc botehdcl
botelhcd botelhdc botelchd botelcdh boteldch boteldhc botedhlc botedhcl botedlhc botedlch botedclh
botedchl botdchel botdchle botdcehl botdcelh botdcleh botdclhe botdhcel botdhcle botdhecl botdhelc
botdhlec botdhlce botdehcl botdehlc botdechl botdeclh botdelch botdelhc botdlhec botdlhce botdlehc
botdlech botdlceh botdlche boctlhed boctlhde boctlehd boctledh boctldeh boctldhe bocthled bocthlde
boctheld bocthedl bocthdel bocthdle boctehld boctehdl boctelhd bocteldh boctedlh boctedhl boctdhel
boctdhle boctdehl boctdelh boctdleh boctdlhe boclthed boclthde bocltehd bocltedh bocltdeh bocltdhe
boclhted boclhtde boclhetd boclhedt boclhdet boclhdte boclehtd boclehdt boclethd bocletdh bocledth
bocledht bocldhet bocldhte bocldeht bocldeth bocldteh bocldthe bochlted bochltde bochletd bochledt
bochldet bochldte bochtled bochtlde bochteld bochtedl bochtdel bochtdle bochetld bochetdl bocheltd
bocheldt bochedlt bochedtl bochdtel bochdtle bochdetl bochdelt bochdlet bochdlte bocelhtd bocelhdt
bocelthd boceltdh boceldth boceldht bocehltd bocehldt bocehtld bocehtdl bocehdtl bocehdlt bocethld
bocethdl bocetlhd bocetldh bocetdlh bocetdhl bocedhtl bocedhlt bocedthl bocedtlh bocedlth bocedlht
bocdlhet bocdlhte bocdleht bocdleth bocdlteh bocdlthe bocdhlet bocdhlte bocdhelt bocdhetl bocdhtel
bocdhtle bocdehlt bocdehtl bocdelht bocdelth bocdetlh bocdethl bocdthel bocdthle bocdtehl bocdtelh
bocdtleh bocdtlhe bohtcled bohtclde bohtceld bohtcedl bohtcdel bohtcdle bohtlced bohtlcde bohtlecd
bohtledc bohtldec bohtldce bohtelcd bohteldc bohtecld bohtecdl bohtedcl bohtedlc bohtdlec bohtdlce
bohtdelc bohtdecl bohtdcel bohtdcle bohctled bohctlde bohcteld bohctedl bohctdel bohctdle bohclted
bohcltde bohcletd bohcledt bohcldet bohcldte bohceltd bohceldt bohcetld bohcetdl bohcedtl bohcedlt
bohcdlet bohcdlte bohcdelt bohcdetl bohcdtel bohcdtle bohlcted bohlctde bohlcetd bohlcedt bohlcdet
bohlcdte bohltced bohltcde bohltecd bohltedc bohltdec bohltdce bohletcd bohletdc bohlectd bohlecdt
bohledct bohledtc bohldtec bohldtce bohldetc bohldect bohldcet bohldcte bohecltd bohecldt bohectld
bohectdl bohecdtl bohecdlt bohelctd bohelcdt boheltcd boheltdc boheldtc boheldct bohetlcd bohetldc
bohetcld bohetcdl bohetdcl bohetdlc bohedltc bohedlct bohedtlc bohedtcl bohedctl bohedclt bohdclet
bohdclte bohdcelt bohdcetl bohdctel bohdctle bohdlcet bohdlcte bohdlect bohdletc bohdltec bohdltce
bohdelct bohdeltc bohdeclt bohdectl bohdetcl bohdetlc bohdtlec bohdtlce bohdtelc bohdtecl bohdtcel
bohdtcle boetchld boetchdl boetclhd boetcldh boetcdlh boetcdhl boethcld boethcdl boethlcd boethldc
boethdlc boethdcl boetlhcd boetlhdc boetlchd boetlcdh boetldch boetldhc boetdhlc boetdhcl boetdlhc
boetdlch boetdclh boetdchl boecthld boecthdl boectlhd boectldh boectdlh boectdhl boechtld boechtdl
boechltd boechldt boechdlt boechdtl boeclhtd boeclhdt boeclthd boecltdh boecldth boecldht boecdhlt
boecdhtl boecdlht boecdlth boecdtlh boecdthl boehctld boehctdl boehcltd boehcldt boehcdlt boehcdtl
boehtcld boehtcdl boehtlcd boehtldc boehtdlc boehtdcl boehltcd boehltdc boehlctd boehlcdt boehldct
boehldtc boehdtlc boehdtcl boehdltc boehdlct boehdclt boehdctl boelchtd boelchdt boelcthd boelctdh
boelcdth boelcdht boelhctd boelhcdt boelhtcd boelhtdc boelhdtc boelhdct boelthcd boelthdc boeltchd
boeltcdh boeltdch boeltdhc boeldhtc boeldhct boeldthc boeldtch boeldcth boeldcht boedchlt boedchtl
boedclht boedclth boedctlh boedcthl boedhclt boedhctl boedhlct boedhltc boedhtlc boedhtcl boedlhct
boedlhtc boedlcht boedlcth boedltch boedlthc boedthlc boedthcl boedtlhc boedtlch boedtclh boedtchl
bodtchel bodtchle bodtcehl bodtcelh bodtcleh bodtclhe bodthcel bodthcle bodthecl bodthelc bodthlec
bodthlce bodtehcl bodtehlc bodtechl bodteclh bodtelch bodtelhc bodtlhec bodtlhce bodtlehc bodtlech
bodtlceh bodtlche bodcthel bodcthle bodctehl bodctelh bodctleh bodctlhe bodchtel bodchtle bodchetl
bodchelt bodchlet bodchlte bodcehtl bodcehlt bodcethl bodcetlh bodcelth bodcelht bodclhet bodclhte
bodcleht bodcleth bodclteh bodclthe bodhctel bodhctle bodhcetl bodhcelt bodhclet bodhclte bodhtcel
bodhtcle bodhtecl bodhtelc bodhtlec bodhtlce bodhetcl bodhetlc bodhectl bodheclt bodhelct bodheltc
bodhltec bodhltce bodhletc bodhlect bodhlcet bodhlcte bodechtl bodechlt bodecthl bodectlh bodeclth
bodeclht bodehctl bodehclt bodehtcl bodehtlc bodehltc bodehlct bodethcl bodethlc bodetchl bodetclh
bodetlch bodetlhc bodelhtc bodelhct bodelthc bodeltch bodelcth bodelcht bodlchet bodlchte bodlceht
bodlceth bodlcteh bodlcthe bodlhcet bodlhcte bodlhect bodlhetc bodlhtec bodlhtce bodlehct bodlehtc
bodlecht bodlecth bodletch bodlethc bodlthec bodlthce bodltehc bodltech bodltceh bodltche btolched
btolchde btolcehd btolcedh btolcdeh btolcdhe btolhced btolhcde btolhecd btolhedc btolhdec btolhdce
btolehcd btolehdc btolechd btolecdh btoledch btoledhc btoldhec btoldhce btoldehc btoldech btoldceh
btoldche btoclhed btoclhde btoclehd btocledh btocldeh btocldhe btochled btochlde btocheld btochedl
btochdel btochdle btocehld btocehdl btocelhd btoceldh btocedlh btocedhl btocdhel btocdhle btocdehl
btocdelh btocdleh btocdlhe btohcled btohclde btohceld btohcedl btohcdel btohcdle btohlced btohlcde
btohlecd btohledc btohldec btohldce btohelcd btoheldc btohecld btohecdl btohedcl btohedlc btohdlec
btohdlce btohdelc btohdecl btohdcel btohdcle btoechld btoechdl btoeclhd btoecldh btoecdlh btoecdhl
btoehcld btoehcdl btoehlcd btoehldc btoehdlc btoehdcl btoelhcd btoelhdc btoelchd btoelcdh btoeldch
btoeldhc btoedhlc btoedhcl btoedlhc btoedlch btoedclh btoedchl btodchel btodchle btodcehl btodcelh
btodcleh btodclhe btodhcel btodhcle btodhecl btodhelc btodhlec btodhlce btodehcl btodehlc btodechl
btodeclh btodelch btodelhc btodlhec btodlhce btodlehc btodlech btodlceh btodlche btloched btlochde
btlocehd btlocedh btlocdeh btlocdhe btlohced btlohcde btlohecd btlohedc btlohdec btlohdce btloehcd
btloehdc btloechd btloecdh btloedch btloedhc btlodhec btlodhce btlodehc btlodech btlodceh btlodche
btlcohed btlcohde btlcoehd btlcoedh btlcodeh btlcodhe btlchoed btlchode btlcheod btlchedo btlchdeo
btlchdoe btlcehod btlcehdo btlceohd btlceodh btlcedoh btlcedho btlcdheo btlcdhoe btlcdeho btlcdeoh
btlcdoeh btlcdohe btlhcoed btlhcode btlhceod btlhcedo btlhcdeo btlhcdoe btlhoced btlhocde btlhoecd
btlhoedc btlhodec btlhodce btlheocd btlheodc btlhecod btlhecdo btlhedco btlhedoc btlhdoec btlhdoce
btlhdeoc btlhdeco btlhdceo btlhdcoe btlechod btlechdo btlecohd btlecodh btlecdoh btlecdho btlehcod
btlehcdo btlehocd btlehodc btlehdoc btlehdco btleohcd btleohdc btleochd btleocdh btleodch btleodhc
btledhoc btledhco btledohc btledoch btledcoh btledcho btldcheo btldchoe btldceho btldceoh btldcoeh
btldcohe btldhceo btldhcoe btldheco btldheoc btldhoec btldhoce btldehco btldehoc btldecho btldecoh
btldeoch btldeohc btldohec btldohce btldoehc btldoech btldoceh btldoche btclohed btclohde btcloehd
btcloedh btclodeh btclodhe btclhoed btclhode btclheod btclhedo btclhdeo btclhdoe btclehod btclehdo
btcleohd btcleodh btcledoh btcledho btcldheo btcldhoe btcldeho btcldeoh btcldoeh btcldohe btcolhed
btcolhde btcolehd btcoledh btcoldeh btcoldhe btcohled btcohlde btcoheld btcohedl btcohdel btcohdle
btcoehld btcoehdl btcoelhd btcoeldh btcoedlh btcoedhl btcodhel btcodhle btcodehl btcodelh btcodleh
btcodlhe btcholed btcholde btchoeld btchoedl btchodel btchodle btchloed btchlode btchleod btchledo
btchldeo btchldoe btchelod btcheldo btcheold btcheodl btchedol btchedlo btchdleo btchdloe btchdelo
btchdeol btchdoel btchdole btceohld btceohdl btceolhd btceoldh btceodlh btceodhl btcehold btcehodl
btcehlod btcehldo btcehdlo btcehdol btcelhod btcelhdo btcelohd btcelodh btceldoh btceldho btcedhlo
btcedhol btcedlho btcedloh btcedolh btcedohl btcdohel btcdohle btcdoehl btcdoelh btcdoleh btcdolhe
btcdhoel btcdhole btcdheol btcdhelo btcdhleo btcdhloe btcdehol btcdehlo btcdeohl btcdeolh btcdeloh
btcdelho btcdlheo btcdlhoe btcdleho btcdleoh btcdloeh btcdlohe bthlcoed bthlcode bthlceod bthlcedo
bthlcdeo bthlcdoe bthloced bthlocde bthloecd bthloedc bthlodec bthlodce bthleocd bthleodc bthlecod
bthlecdo bthledco bthledoc bthldoec bthldoce bthldeoc bthldeco bthldceo bthldcoe bthcloed bthclode
bthcleod bthcledo bthcldeo bthcldoe bthcoled bthcolde bthcoeld bthcoedl bthcodel bthcodle bthceold
bthceodl bthcelod bthceldo bthcedlo bthcedol bthcdoel bthcdole bthcdeol bthcdelo bthcdleo bthcdloe
bthocled bthoclde bthoceld bthocedl bthocdel bthocdle btholced btholcde btholecd btholedc btholdec
btholdce bthoelcd bthoeldc bthoecld bthoecdl bthoedcl bthoedlc bthodlec bthodlce bthodelc bthodecl
bthodcel bthodcle bthecold bthecodl btheclod bthecldo bthecdlo bthecdol btheocld btheocdl btheolcd
btheoldc btheodlc btheodcl bthelocd bthelodc bthelcod bthelcdo btheldco btheldoc bthedolc bthedocl
bthedloc bthedlco bthedclo bthedcol bthdcoel bthdcole bthdceol bthdcelo bthdcleo bthdcloe bthdocel
bthdocle bthdoecl bthdoelc bthdolec bthdolce bthdeocl bthdeolc bthdecol bthdeclo bthdelco bthdeloc
bthdloec bthdloce bthdleoc bthdleco bthdlceo bthdlcoe btelchod btelchdo btelcohd btelcodh btelcdoh
btelcdho btelhcod btelhcdo btelhocd btelhodc btelhdoc btelhdco btelohcd btelohdc btelochd btelocdh
btelodch btelodhc bteldhoc bteldhco bteldohc bteldoch bteldcoh bteldcho bteclhod bteclhdo bteclohd
bteclodh btecldoh btecldho btechlod btechldo btechold btechodl btechdol btechdlo btecohld btecohdl
btecolhd btecoldh btecodlh btecodhl btecdhol btecdhlo btecdohl btecdolh btecdloh btecdlho btehclod
btehcldo btehcold btehcodl btehcdol btehcdlo btehlcod btehlcdo btehlocd btehlodc btehldoc btehldco
bteholcd bteholdc btehocld btehocdl btehodcl btehodlc btehdloc btehdlco btehdolc btehdocl btehdcol
btehdclo bteochld bteochdl bteoclhd bteocldh bteocdlh bteocdhl bteohcld bteohcdl bteohlcd bteohldc
bteohdlc bteohdcl bteolhcd bteolhdc bteolchd bteolcdh bteoldch bteoldhc bteodhlc bteodhcl bteodlhc
bteodlch bteodclh bteodchl btedchol btedchlo btedcohl btedcolh btedcloh btedclho btedhcol btedhclo
btedhocl btedholc btedhloc btedhlco btedohcl btedohlc btedochl btedoclh btedolch btedolhc btedlhoc
btedlhco btedlohc btedloch btedlcoh btedlcho btdlcheo btdlchoe btdlceho btdlceoh btdlcoeh btdlcohe
btdlhceo btdlhcoe btdlheco btdlheoc btdlhoec btdlhoce btdlehco btdlehoc btdlecho btdlecoh btdleoch
btdleohc btdlohec btdlohce btdloehc btdloech btdloceh btdloche btdclheo btdclhoe btdcleho btdcleoh
btdcloeh btdclohe btdchleo btdchloe btdchelo btdcheol btdchoel btdchole btdcehlo btdcehol btdcelho
btdceloh btdceolh btdceohl btdcohel btdcohle btdcoehl btdcoelh btdcoleh btdcolhe btdhcleo btdhcloe
btdhcelo btdhceol btdhcoel btdhcole btdhlceo btdhlcoe btdhleco btdhleoc btdhloec btdhloce btdhelco
btdheloc btdheclo btdhecol btdheocl btdheolc btdholec btdholce btdhoelc btdhoecl btdhocel btdhocle
btdechlo btdechol btdeclho btdecloh btdecolh btdecohl btdehclo btdehcol btdehlco btdehloc btdeholc
btdehocl btdelhco btdelhoc btdelcho btdelcoh btdeloch btdelohc btdeohlc btdeohcl btdeolhc btdeolch
btdeoclh btdeochl btdochel btdochle btdocehl btdocelh btdocleh btdoclhe btdohcel btdohcle btdohecl
btdohelc btdohlec btdohlce btdoehcl btdoehlc btdoechl btdoeclh btdoelch btdoelhc btdolhec btdolhce
btdolehc btdolech btdolceh btdolche bcotlhed bcotlhde bcotlehd bcotledh bcotldeh bcotldhe bcothled
bcothlde bcotheld bcothedl bcothdel bcothdle bcotehld bcotehdl bcotelhd bcoteldh bcotedlh bcotedhl
bcotdhel bcotdhle bcotdehl bcotdelh bcotdleh bcotdlhe bcolthed bcolthde bcoltehd bcoltedh bcoltdeh
bcoltdhe bcolhted bcolhtde bcolhetd bcolhedt bcolhdet bcolhdte bcolehtd bcolehdt bcolethd bcoletdh
bcoledth bcoledht bcoldhet bcoldhte bcoldeht bcoldeth bcoldteh bcoldthe bcohlted bcohltde bcohletd
bcohledt bcohldet bcohldte bcohtled bcohtlde bcohteld bcohtedl bcohtdel bcohtdle bcohetld bcohetdl
bcoheltd bcoheldt bcohedlt bcohedtl bcohdtel bcohdtle bcohdetl bcohdelt bcohdlet bcohdlte bcoelhtd
bcoelhdt bcoelthd bcoeltdh bcoeldth bcoeldht bcoehltd bcoehldt bcoehtld bcoehtdl bcoehdtl bcoehdlt
bcoethld bcoethdl bcoetlhd bcoetldh bcoetdlh bcoetdhl bcoedhtl bcoedhlt bcoedthl bcoedtlh bcoedlth
bcoedlht bcodlhet bcodlhte bcodleht bcodleth bcodlteh bcodlthe bcodhlet bcodhlte bcodhelt bcodhetl
bcodhtel bcodhtle bcodehlt bcodehtl bcodelht bcodelth bcodetlh bcodethl bcodthel bcodthle bcodtehl
bcodtelh bcodtleh bcodtlhe bctolhed bctolhde bctolehd bctoledh bctoldeh bctoldhe bctohled bctohlde
bctoheld bctohedl bctohdel bctohdle bctoehld bctoehdl bctoelhd bctoeldh bctoedlh bctoedhl bctodhel
bctodhle bctodehl bctodelh bctodleh bctodlhe bctlohed bctlohde bctloehd bctloedh bctlodeh bctlodhe
bctlhoed bctlhode bctlheod bctlhedo bctlhdeo bctlhdoe bctlehod bctlehdo bctleohd bctleodh bctledoh
bctledho bctldheo bctldhoe bctldeho bctldeoh bctldoeh bctldohe bcthloed bcthlode bcthleod bcthledo
bcthldeo bcthldoe bctholed bctholde bcthoeld bcthoedl bcthodel bcthodle bctheold bctheodl bcthelod
bctheldo bcthedlo bcthedol bcthdoel bcthdole bcthdeol bcthdelo bcthdleo bcthdloe bctelhod bctelhdo
bctelohd bctelodh bcteldoh bcteldho bctehlod bctehldo bctehold bctehodl bctehdol bctehdlo bcteohld
bcteohdl bcteolhd bcteoldh bcteodlh bcteodhl bctedhol bctedhlo bctedohl bctedolh bctedloh bctedlho
bctdlheo bctdlhoe bctdleho bctdleoh bctdloeh bctdlohe bctdhleo bctdhloe bctdhelo bctdheol bctdhoel
bctdhole bctdehlo bctdehol bctdelho bctdeloh bctdeolh bctdeohl bctdohel bctdohle bctdoehl bctdoelh
bctdoleh bctdolhe bcltohed bcltohde bcltoehd bcltoedh bcltodeh bcltodhe bclthoed bclthode bcltheod
bclthedo bclthdeo bclthdoe bcltehod bcltehdo bclteohd bclteodh bcltedoh bcltedho bcltdheo bcltdhoe
bcltdeho bcltdeoh bcltdoeh bcltdohe bclothed bclothde bclotehd bclotedh bclotdeh bclotdhe bclohted
bclohtde bclohetd bclohedt bclohdet bclohdte bcloehtd bcloehdt bcloethd bcloetdh bcloedth bcloedht
bclodhet bclodhte bclodeht bclodeth bclodteh bclodthe bclhoted bclhotde bclhoetd bclhoedt bclhodet
bclhodte bclhtoed bclhtode bclhteod bclhtedo bclhtdeo bclhtdoe bclhetod bclhetdo bclheotd bclheodt
bclhedot bclhedto bclhdteo bclhdtoe bclhdeto bclhdeot bclhdoet bclhdote bcleohtd bcleohdt bcleothd
bcleotdh bcleodth bcleodht bclehotd bclehodt bclehtod bclehtdo bclehdto bclehdot bclethod bclethdo
bcletohd bcletodh bcletdoh bcletdho bcledhto bcledhot bcledtho bcledtoh bcledoth bcledoht bcldohet
bcldohte bcldoeht bcldoeth bcldoteh bcldothe bcldhoet bcldhote bcldheot bcldheto bcldhteo bcldhtoe
bcldehot bcldehto bcldeoht bcldeoth bcldetoh bcldetho bcldtheo bcldthoe bcldteho bcldteoh bcldtoeh
bcldtohe bchtloed bchtlode bchtleod bchtledo bchtldeo bchtldoe bchtoled bchtolde bchtoeld bchtoedl
bchtodel bchtodle bchteold bchteodl bchtelod bchteldo bchtedlo bchtedol bchtdoel bchtdole bchtdeol
bchtdelo bchtdleo bchtdloe bchltoed bchltode bchlteod bchltedo bchltdeo bchltdoe bchloted bchlotde
bchloetd bchloedt bchlodet bchlodte bchleotd bchleodt bchletod bchletdo bchledto bchledot bchldoet
bchldote bchldeot bchldeto bchldteo bchldtoe bcholted bcholtde bcholetd bcholedt bcholdet bcholdte
bchotled bchotlde bchoteld bchotedl bchotdel bchotdle bchoetld bchoetdl bchoeltd bchoeldt bchoedlt
bchoedtl bchodtel bchodtle bchodetl bchodelt bchodlet bchodlte bchelotd bchelodt bcheltod bcheltdo
bcheldto bcheldot bcheoltd bcheoldt bcheotld bcheotdl bcheodtl bcheodlt bchetold bchetodl bchetlod
bchetldo bchetdlo bchetdol bchedotl bchedolt bchedtol bchedtlo bchedlto bchedlot bchdloet bchdlote
bchdleot bchdleto bchdlteo bchdltoe bchdolet bchdolte bchdoelt bchdoetl bchdotel bchdotle bchdeolt
bchdeotl bchdelot bchdelto bchdetlo bchdetol bchdtoel bchdtole bchdteol bchdtelo bchdtleo bchdtloe
bcetlhod bcetlhdo bcetlohd bcetlodh bcetldoh bcetldho bcethlod bcethldo bcethold bcethodl bcethdol
bcethdlo bcetohld bcetohdl bcetolhd bcetoldh bcetodlh bcetodhl bcetdhol bcetdhlo bcetdohl bcetdolh
bcetdloh bcetdlho bcelthod bcelthdo bceltohd bceltodh bceltdoh bceltdho bcelhtod bcelhtdo bcelhotd
bcelhodt bcelhdot bcelhdto bcelohtd bcelohdt bcelothd bcelotdh bcelodth bcelodht bceldhot bceldhto
bceldoht bceldoth bceldtoh bceldtho bcehltod bcehltdo bcehlotd bcehlodt bcehldot bcehldto bcehtlod
bcehtldo bcehtold bcehtodl bcehtdol bcehtdlo bcehotld bcehotdl bceholtd bceholdt bcehodlt bcehodtl
bcehdtol bcehdtlo bcehdotl bcehdolt bcehdlot bcehdlto bceolhtd bceolhdt bceolthd bceoltdh bceoldth
bceoldht bceohltd bceohldt bceohtld bceohtdl bceohdtl bceohdlt bceothld bceothdl bceotlhd bceotldh
bceotdlh bceotdhl bceodhtl bceodhlt bceodthl bceodtlh bceodlth bceodlht bcedlhot bcedlhto bcedloht
bcedloth bcedltoh bcedltho bcedhlot bcedhlto bcedholt bcedhotl bcedhtol bcedhtlo bcedohlt bcedohtl
bcedolht bcedolth bcedotlh bcedothl bcedthol bcedthlo bcedtohl bcedtolh bcedtloh bcedtlho bcdtlheo
bcdtlhoe bcdtleho bcdtleoh bcdtloeh bcdtlohe bcdthleo bcdthloe bcdthelo bcdtheol bcdthoel bcdthole
bcdtehlo bcdtehol bcdtelho bcdteloh bcdteolh bcdteohl bcdtohel bcdtohle bcdtoehl bcdtoelh bcdtoleh
bcdtolhe bcdltheo bcdlthoe bcdlteho bcdlteoh bcdltoeh bcdltohe bcdlhteo bcdlhtoe bcdlheto bcdlheot
bcdlhoet bcdlhote bcdlehto bcdlehot bcdletho bcdletoh bcdleoth bcdleoht bcdlohet bcdlohte bcdloeht
bcdloeth bcdloteh bcdlothe bcdhlteo bcdhltoe bcdhleto bcdhleot bcdhloet bcdhlote bcdhtleo bcdhtloe
bcdhtelo bcdhteol bcdhtoel bcdhtole bcdhetlo bcdhetol bcdhelto bcdhelot bcdheolt bcdheotl bcdhotel
bcdhotle bcdhoetl bcdhoelt bcdholet bcdholte bcdelhto bcdelhot bcdeltho bcdeltoh bcdeloth bcdeloht
bcdehlto bcdehlot bcdehtlo bcdehtol bcdehotl bcdeholt bcdethlo bcdethol bcdetlho bcdetloh bcdetolh
bcdetohl bcdeohtl bcdeohlt bcdeothl bcdeotlh bcdeolth bcdeolht bcdolhet bcdolhte bcdoleht bcdoleth
bcdolteh bcdolthe bcdohlet bcdohlte bcdohelt bcdohetl bcdohtel bcdohtle bcdoehlt bcdoehtl bcdoelht
bcdoelth bcdoetlh bcdoethl bcdothel bcdothle bcdotehl bcdotelh bcdotleh bcdotlhe bhotcled bhotclde
bhotceld bhotcedl bhotcdel bhotcdle bhotlced bhotlcde bhotlecd bhotledc bhotldec bhotldce bhotelcd
bhoteldc bhotecld bhotecdl bhotedcl bhotedlc bhotdlec bhotdlce bhotdelc bhotdecl bhotdcel bhotdcle
bhoctled bhoctlde bhocteld bhoctedl bhoctdel bhoctdle bhoclted bhocltde bhocletd bhocledt bhocldet
bhocldte bhoceltd bhoceldt bhocetld bhocetdl bhocedtl bhocedlt bhocdlet bhocdlte bhocdelt bhocdetl
bhocdtel bhocdtle bholcted bholctde bholcetd bholcedt bholcdet bholcdte bholtced bholtcde bholtecd
bholtedc bholtdec bholtdce bholetcd bholetdc bholectd bholecdt bholedct bholedtc bholdtec bholdtce
bholdetc bholdect bholdcet bholdcte bhoecltd bhoecldt bhoectld bhoectdl bhoecdtl bhoecdlt bhoelctd
bhoelcdt bhoeltcd bhoeltdc bhoeldtc bhoeldct bhoetlcd bhoetldc bhoetcld bhoetcdl bhoetdcl bhoetdlc
bhoedltc bhoedlct bhoedtlc bhoedtcl bhoedctl bhoedclt bhodclet bhodclte bhodcelt bhodcetl bhodctel
bhodctle bhodlcet bhodlcte bhodlect bhodletc bhodltec bhodltce bhodelct bhodeltc bhodeclt bhodectl
bhodetcl bhodetlc bhodtlec bhodtlce bhodtelc bhodtecl bhodtcel bhodtcle bhtocled bhtoclde bhtoceld
bhtocedl bhtocdel bhtocdle bhtolced bhtolcde bhtolecd bhtoledc bhtoldec bhtoldce bhtoelcd bhtoeldc
bhtoecld bhtoecdl bhtoedcl bhtoedlc bhtodlec bhtodlce bhtodelc bhtodecl bhtodcel bhtodcle bhtcoled
bhtcolde bhtcoeld bhtcoedl bhtcodel bhtcodle bhtcloed bhtclode bhtcleod bhtcledo bhtcldeo bhtcldoe
bhtcelod bhtceldo bhtceold bhtceodl bhtcedol bhtcedlo bhtcdleo bhtcdloe bhtcdelo bhtcdeol bhtcdoel
bhtcdole bhtlcoed bhtlcode bhtlceod bhtlcedo bhtlcdeo bhtlcdoe bhtloced bhtlocde bhtloecd bhtloedc
bhtlodec bhtlodce bhtleocd bhtleodc bhtlecod bhtlecdo bhtledco bhtledoc bhtldoec bhtldoce bhtldeoc
bhtldeco bhtldceo bhtldcoe bhteclod bhtecldo bhtecold bhtecodl bhtecdol bhtecdlo bhtelcod bhtelcdo
bhtelocd bhtelodc bhteldoc bhteldco bhteolcd bhteoldc bhteocld bhteocdl bhteodcl bhteodlc bhtedloc
bhtedlco bhtedolc bhtedocl bhtedcol bhtedclo bhtdcleo bhtdcloe bhtdcelo bhtdceol bhtdcoel bhtdcole
bhtdlceo bhtdlcoe bhtdleco bhtdleoc bhtdloec bhtdloce bhtdelco bhtdeloc bhtdeclo bhtdecol bhtdeocl
bhtdeolc bhtdolec bhtdolce bhtdoelc bhtdoecl bhtdocel bhtdocle bhctoled bhctolde bhctoeld bhctoedl
bhctodel bhctodle bhctloed bhctlode bhctleod bhctledo bhctldeo bhctldoe bhctelod bhcteldo bhcteold
bhcteodl bhctedol bhctedlo bhctdleo bhctdloe bhctdelo bhctdeol bhctdoel bhctdole bhcotled bhcotlde
bhcoteld bhcotedl bhcotdel bhcotdle bhcolted bhcoltde bhcoletd bhcoledt bhcoldet bhcoldte bhcoeltd
bhcoeldt bhcoetld bhcoetdl bhcoedtl bhcoedlt bhcodlet bhcodlte bhcodelt bhcodetl bhcodtel bhcodtle
bhcloted bhclotde bhcloetd bhcloedt bhclodet bhclodte bhcltoed bhcltode bhclteod bhcltedo bhcltdeo
bhcltdoe bhcletod bhcletdo bhcleotd bhcleodt bhcledot bhcledto bhcldteo bhcldtoe bhcldeto bhcldeot
bhcldoet bhcldote bhceoltd bhceoldt bhceotld bhceotdl bhceodtl bhceodlt bhcelotd bhcelodt bhceltod
bhceltdo bhceldto bhceldot bhcetlod bhcetldo bhcetold bhcetodl bhcetdol bhcetdlo bhcedlto bhcedlot
bhcedtlo bhcedtol bhcedotl bhcedolt bhcdolet bhcdolte bhcdoelt bhcdoetl bhcdotel bhcdotle bhcdloet
bhcdlote bhcdleot bhcdleto bhcdlteo bhcdltoe bhcdelot bhcdelto bhcdeolt bhcdeotl bhcdetol bhcdetlo
bhcdtleo bhcdtloe bhcdtelo bhcdteol bhcdtoel bhcdtole bhltcoed bhltcode bhltceod bhltcedo bhltcdeo
bhltcdoe bhltoced bhltocde bhltoecd bhltoedc bhltodec bhltodce bhlteocd bhlteodc bhltecod bhltecdo
bhltedco bhltedoc bhltdoec bhltdoce bhltdeoc bhltdeco bhltdceo bhltdcoe bhlctoed bhlctode bhlcteod
bhlctedo bhlctdeo bhlctdoe bhlcoted bhlcotde bhlcoetd bhlcoedt bhlcodet bhlcodte bhlceotd bhlceodt
bhlcetod bhlcetdo bhlcedto bhlcedot bhlcdoet bhlcdote bhlcdeot bhlcdeto bhlcdteo bhlcdtoe bhlocted
bhloctde bhlocetd bhlocedt bhlocdet bhlocdte bhlotced bhlotcde bhlotecd bhlotedc bhlotdec bhlotdce
bhloetcd bhloetdc bhloectd bhloecdt bhloedct bhloedtc bhlodtec bhlodtce bhlodetc bhlodect bhlodcet
bhlodcte bhlecotd bhlecodt bhlectod bhlectdo bhlecdto bhlecdot bhleoctd bhleocdt bhleotcd bhleotdc
bhleodtc bhleodct bhletocd bhletodc bhletcod bhletcdo bhletdco bhletdoc bhledotc bhledoct bhledtoc
bhledtco bhledcto bhledcot bhldcoet bhldcote bhldceot bhldceto bhldcteo bhldctoe bhldocet bhldocte
bhldoect bhldoetc bhldotec bhldotce bhldeoct bhldeotc bhldecot bhldecto bhldetco bhldetoc bhldtoec
bhldtoce bhldteoc bhldteco bhldtceo bhldtcoe bhetclod bhetcldo bhetcold bhetcodl bhetcdol bhetcdlo
bhetlcod bhetlcdo bhetlocd bhetlodc bhetldoc bhetldco bhetolcd bhetoldc bhetocld bhetocdl bhetodcl
bhetodlc bhetdloc bhetdlco bhetdolc bhetdocl bhetdcol bhetdclo bhectlod bhectldo bhectold bhectodl
bhectdol bhectdlo bhecltod bhecltdo bheclotd bheclodt bhecldot bhecldto bhecoltd bhecoldt bhecotld
bhecotdl bhecodtl bhecodlt bhecdlot bhecdlto bhecdolt bhecdotl bhecdtol bhecdtlo bhelctod bhelctdo
bhelcotd bhelcodt bhelcdot bhelcdto bheltcod bheltcdo bheltocd bheltodc bheltdoc bheltdco bhelotcd
bhelotdc bheloctd bhelocdt bhelodct bhelodtc bheldtoc bheldtco bheldotc bheldoct bheldcot bheldcto
bheocltd bheocldt bheoctld bheoctdl bheocdtl bheocdlt bheolctd bheolcdt bheoltcd bheoltdc bheoldtc
bheoldct bheotlcd bheotldc bheotcld bheotcdl bheotdcl bheotdlc bheodltc bheodlct bheodtlc bheodtcl
bheodctl bheodclt bhedclot bhedclto bhedcolt bhedcotl bhedctol bhedctlo bhedlcot bhedlcto bhedloct
bhedlotc bhedltoc bhedltco bhedolct bhedoltc bhedoclt bhedoctl bhedotcl bhedotlc bhedtloc bhedtlco
bhedtolc bhedtocl bhedtcol bhedtclo bhdtcleo bhdtcloe bhdtcelo bhdtceol bhdtcoel bhdtcole bhdtlceo
bhdtlcoe bhdtleco bhdtleoc bhdtloec bhdtloce bhdtelco bhdteloc bhdteclo bhdtecol bhdteocl bhdteolc
bhdtolec bhdtolce bhdtoelc bhdtoecl bhdtocel bhdtocle bhdctleo bhdctloe bhdctelo bhdcteol bhdctoel
bhdctole bhdclteo bhdcltoe bhdcleto bhdcleot bhdcloet bhdclote bhdcelto bhdcelot bhdcetlo bhdcetol
bhdceotl bhdceolt bhdcolet bhdcolte bhdcoelt bhdcoetl bhdcotel bhdcotle bhdlcteo bhdlctoe bhdlceto
bhdlceot bhdlcoet bhdlcote bhdltceo bhdltcoe bhdlteco bhdlteoc bhdltoec bhdltoce bhdletco bhdletoc
bhdlecto bhdlecot bhdleoct bhdleotc bhdlotec bhdlotce bhdloetc bhdloect bhdlocet bhdlocte bhdeclto
bhdeclot bhdectlo bhdectol bhdecotl bhdecolt bhdelcto bhdelcot bhdeltco bhdeltoc bhdelotc bhdeloct
bhdetlco bhdetloc bhdetclo bhdetcol bhdetocl bhdetolc bhdeoltc bhdeolct bhdeotlc bhdeotcl bhdeoctl
bhdeoclt bhdoclet bhdoclte bhdocelt bhdocetl bhdoctel bhdoctle bhdolcet bhdolcte bhdolect bhdoletc
bhdoltec bhdoltce bhdoelct bhdoeltc bhdoeclt bhdoectl bhdoetcl bhdoetlc bhdotlec bhdotlce bhdotelc
bhdotecl bhdotcel bhdotcle beotchld beotchdl beotclhd beotcldh beotcdlh beotcdhl beothcld beothcdl
beothlcd beothldc beothdlc beothdcl beotlhcd beotlhdc beotlchd beotlcdh beotldch beotldhc beotdhlc
beotdhcl beotdlhc beotdlch beotdclh beotdchl beocthld beocthdl beoctlhd beoctldh beoctdlh beoctdhl
beochtld beochtdl beochltd beochldt beochdlt beochdtl beoclhtd beoclhdt beoclthd beocltdh beocldth
beocldht beocdhlt beocdhtl beocdlht beocdlth beocdtlh beocdthl beohctld beohctdl beohcltd beohcldt
beohcdlt beohcdtl beohtcld beohtcdl beohtlcd beohtldc beohtdlc beohtdcl beohltcd beohltdc beohlctd
beohlcdt beohldct beohldtc beohdtlc beohdtcl beohdltc beohdlct beohdclt beohdctl beolchtd beolchdt
beolcthd beolctdh beolcdth beolcdht beolhctd beolhcdt beolhtcd beolhtdc beolhdtc beolhdct beolthcd
beolthdc beoltchd beoltcdh beoltdch beoltdhc beoldhtc beoldhct beoldthc beoldtch beoldcth beoldcht
beodchlt beodchtl beodclht beodclth beodctlh beodcthl beodhclt beodhctl beodhlct beodhltc beodhtlc
beodhtcl beodlhct beodlhtc beodlcht beodlcth beodltch beodlthc beodthlc beodthcl beodtlhc beodtlch
beodtclh beodtchl betochld betochdl betoclhd betocldh betocdlh betocdhl betohcld betohcdl betohlcd
betohldc betohdlc betohdcl betolhcd betolhdc betolchd betolcdh betoldch betoldhc betodhlc betodhcl
betodlhc betodlch betodclh betodchl betcohld betcohdl betcolhd betcoldh betcodlh betcodhl betchold
betchodl betchlod betchldo betchdlo betchdol betclhod betclhdo betclohd betclodh betcldoh betcldho
betcdhlo betcdhol betcdlho betcdloh betcdolh betcdohl bethcold bethcodl bethclod bethcldo bethcdlo
bethcdol bethocld bethocdl betholcd betholdc bethodlc bethodcl bethlocd bethlodc bethlcod bethlcdo
bethldco bethldoc bethdolc bethdocl bethdloc bethdlco bethdclo bethdcol betlchod betlchdo betlcohd
betlcodh betlcdoh betlcdho betlhcod betlhcdo betlhocd betlhodc betlhdoc betlhdco betlohcd betlohdc
betlochd betlocdh betlodch betlodhc betldhoc betldhco betldohc betldoch betldcoh betldcho betdchlo
betdchol betdclho betdcloh betdcolh betdcohl betdhclo betdhcol betdhlco betdhloc betdholc betdhocl
betdlhco betdlhoc betdlcho betdlcoh betdloch betdlohc betdohlc betdohcl betdolhc betdolch betdoclh
betdochl bectohld bectohdl bectolhd bectoldh bectodlh bectodhl becthold becthodl becthlod becthldo
becthdlo becthdol bectlhod bectlhdo bectlohd bectlodh bectldoh bectldho bectdhlo bectdhol bectdlho
bectdloh bectdolh bectdohl becothld becothdl becotlhd becotldh becotdlh becotdhl becohtld becohtdl
becohltd becohldt becohdlt becohdtl becolhtd becolhdt becolthd becoltdh becoldth becoldht becodhlt
becodhtl becodlht becodlth becodtlh becodthl bechotld bechotdl becholtd becholdt bechodlt bechodtl
bechtold bechtodl bechtlod bechtldo bechtdlo bechtdol bechltod bechltdo bechlotd bechlodt bechldot
bechldto bechdtlo bechdtol bechdlto bechdlot bechdolt bechdotl beclohtd beclohdt beclothd beclotdh
beclodth beclodht beclhotd beclhodt beclhtod beclhtdo beclhdto beclhdot beclthod beclthdo becltohd
becltodh becltdoh becltdho becldhto becldhot becldtho becldtoh becldoth becldoht becdohlt becdohtl
becdolht becdolth becdotlh becdothl becdholt becdhotl becdhlot becdhlto becdhtlo becdhtol becdlhot
becdlhto becdloht becdloth becdltoh becdltho becdthlo becdthol becdtlho becdtloh becdtolh becdtohl
behtcold behtcodl behtclod behtcldo behtcdlo behtcdol behtocld behtocdl behtolcd behtoldc behtodlc
behtodcl behtlocd behtlodc behtlcod behtlcdo behtldco behtldoc behtdolc behtdocl behtdloc behtdlco
behtdclo behtdcol behctold behctodl behctlod behctldo behctdlo behctdol behcotld behcotdl behcoltd
behcoldt behcodlt behcodtl behclotd behclodt behcltod behcltdo behcldto behcldot behcdolt behcdotl
behcdlot behcdlto behcdtlo behcdtol behoctld behoctdl behocltd behocldt behocdlt behocdtl behotcld
behotcdl behotlcd behotldc behotdlc behotdcl beholtcd beholtdc beholctd beholcdt beholdct beholdtc
behodtlc behodtcl behodltc behodlct behodclt behodctl behlcotd behlcodt behlctod behlctdo behlcdto
behlcdot behloctd behlocdt behlotcd behlotdc behlodtc behlodct behltocd behltodc behltcod behltcdo
behltdco behltdoc behldotc behldoct behldtoc behldtco behldcto behldcot behdcolt behdcotl behdclot
behdclto behdctlo behdctol behdoclt behdoctl behdolct behdoltc behdotlc behdotcl behdloct behdlotc
behdlcot behdlcto behdltco behdltoc behdtolc behdtocl behdtloc behdtlco behdtclo behdtcol beltchod
beltchdo beltcohd beltcodh beltcdoh beltcdho belthcod belthcdo belthocd belthodc belthdoc belthdco
beltohcd beltohdc beltochd beltocdh beltodch beltodhc beltdhoc beltdhco beltdohc beltdoch beltdcoh
beltdcho belcthod belcthdo belctohd belctodh belctdoh belctdho belchtod belchtdo belchotd belchodt
belchdot belchdto belcohtd belcohdt belcothd belcotdh belcodth belcodht belcdhot belcdhto belcdoht
belcdoth belcdtoh belcdtho belhctod belhctdo belhcotd belhcodt belhcdot belhcdto belhtcod belhtcdo
belhtocd belhtodc belhtdoc belhtdco belhotcd belhotdc belhoctd belhocdt belhodct belhodtc belhdtoc
belhdtco belhdotc belhdoct belhdcot belhdcto belochtd belochdt belocthd beloctdh belocdth belocdht
belohctd belohcdt belohtcd belohtdc belohdtc belohdct belothcd belothdc belotchd belotcdh belotdch
belotdhc belodhtc belodhct belodthc belodtch belodcth belodcht beldchot beldchto beldcoht beldcoth
beldctoh beldctho beldhcot beldhcto beldhoct beldhotc beldhtoc beldhtco beldohct beldohtc beldocht
beldocth beldotch beldothc beldthoc beldthco beldtohc beldtoch beldtcoh beldtcho bedtchlo bedtchol
bedtclho bedtcloh bedtcolh bedtcohl bedthclo bedthcol bedthlco bedthloc bedtholc bedthocl bedtlhco
bedtlhoc bedtlcho bedtlcoh bedtloch bedtlohc bedtohlc bedtohcl bedtolhc bedtolch bedtoclh bedtochl
bedcthlo bedcthol bedctlho bedctloh bedctolh bedctohl bedchtlo bedchtol bedchlto bedchlot bedcholt
bedchotl bedclhto bedclhot bedcltho bedcltoh bedcloth bedcloht bedcohlt bedcohtl bedcolht bedcolth
bedcotlh bedcothl bedhctlo bedhctol bedhclto bedhclot bedhcolt bedhcotl bedhtclo bedhtcol bedhtlco
bedhtloc bedhtolc bedhtocl bedhltco bedhltoc bedhlcto bedhlcot bedhloct bedhlotc bedhotlc bedhotcl
bedholtc bedholct bedhoclt bedhoctl bedlchto bedlchot bedlctho bedlctoh bedlcoth bedlcoht bedlhcto
bedlhcot bedlhtco bedlhtoc bedlhotc bedlhoct bedlthco bedlthoc bedltcho bedltcoh bedltoch bedltohc
bedlohtc bedlohct bedlothc bedlotch bedlocth bedlocht bedochlt bedochtl bedoclht bedoclth bedoctlh
bedocthl bedohclt bedohctl bedohlct bedohltc bedohtlc bedohtcl bedolhct bedolhtc bedolcht bedolcth
bedoltch bedolthc bedothlc bedothcl bedotlhc bedotlch bedotclh bedotchl bdotchel bdotchle bdotcehl
bdotcelh bdotcleh bdotclhe bdothcel bdothcle bdothecl bdothelc bdothlec bdothlce bdotehcl bdotehlc
bdotechl bdoteclh bdotelch bdotelhc bdotlhec bdotlhce bdotlehc bdotlech bdotlceh bdotlche bdocthel
bdocthle bdoctehl bdoctelh bdoctleh bdoctlhe bdochtel bdochtle bdochetl bdochelt bdochlet bdochlte
bdocehtl bdocehlt bdocethl bdocetlh bdocelth bdocelht bdoclhet bdoclhte bdocleht bdocleth bdoclteh
bdoclthe bdohctel bdohctle bdohcetl bdohcelt bdohclet bdohclte bdohtcel bdohtcle bdohtecl bdohtelc
bdohtlec bdohtlce bdohetcl bdohetlc bdohectl bdoheclt bdohelct bdoheltc bdohltec bdohltce bdohletc
bdohlect bdohlcet bdohlcte bdoechtl bdoechlt bdoecthl bdoectlh bdoeclth bdoeclht bdoehctl bdoehclt
bdoehtcl bdoehtlc bdoehltc bdoehlct bdoethcl bdoethlc bdoetchl bdoetclh bdoetlch bdoetlhc bdoelhtc
bdoelhct bdoelthc bdoeltch bdoelcth bdoelcht bdolchet bdolchte bdolceht bdolceth bdolcteh bdolcthe
bdolhcet bdolhcte bdolhect bdolhetc bdolhtec bdolhtce bdolehct bdolehtc bdolecht bdolecth bdoletch
bdolethc bdolthec bdolthce bdoltehc bdoltech bdoltceh bdoltche bdtochel bdtochle bdtocehl bdtocelh
bdtocleh bdtoclhe bdtohcel bdtohcle bdtohecl bdtohelc bdtohlec bdtohlce bdtoehcl bdtoehlc bdtoechl
bdtoeclh bdtoelch bdtoelhc bdtolhec bdtolhce bdtolehc bdtolech bdtolceh bdtolche bdtcohel bdtcohle
bdtcoehl bdtcoelh bdtcoleh bdtcolhe bdtchoel bdtchole bdtcheol bdtchelo bdtchleo bdtchloe bdtcehol
bdtcehlo bdtceohl bdtceolh bdtceloh bdtcelho bdtclheo bdtclhoe bdtcleho bdtcleoh bdtcloeh bdtclohe
bdthcoel bdthcole bdthceol bdthcelo bdthcleo bdthcloe bdthocel bdthocle bdthoecl bdthoelc bdtholec
bdtholce bdtheocl bdtheolc bdthecol bdtheclo bdthelco bdtheloc bdthloec bdthloce bdthleoc bdthleco
bdthlceo bdthlcoe bdtechol bdtechlo bdtecohl bdtecolh bdtecloh bdteclho bdtehcol bdtehclo bdtehocl
bdteholc bdtehloc bdtehlco bdteohcl bdteohlc bdteochl bdteoclh bdteolch bdteolhc bdtelhoc bdtelhco
bdtelohc bdteloch bdtelcoh bdtelcho bdtlcheo bdtlchoe bdtlceho bdtlceoh bdtlcoeh bdtlcohe bdtlhceo
bdtlhcoe bdtlheco bdtlheoc bdtlhoec bdtlhoce bdtlehco bdtlehoc bdtlecho bdtlecoh bdtleoch bdtleohc
bdtlohec bdtlohce bdtloehc bdtloech bdtloceh bdtloche bdctohel bdctohle bdctoehl bdctoelh bdctoleh
bdctolhe bdcthoel bdcthole bdctheol bdcthelo bdcthleo bdcthloe bdctehol bdctehlo bdcteohl bdcteolh
bdcteloh bdctelho bdctlheo bdctlhoe bdctleho bdctleoh bdctloeh bdctlohe bdcothel bdcothle bdcotehl
bdcotelh bdcotleh bdcotlhe bdcohtel bdcohtle bdcohetl bdcohelt bdcohlet bdcohlte bdcoehtl bdcoehlt
bdcoethl bdcoetlh bdcoelth bdcoelht bdcolhet bdcolhte bdcoleht bdcoleth bdcolteh bdcolthe bdchotel
bdchotle bdchoetl bdchoelt bdcholet bdcholte bdchtoel bdchtole bdchteol bdchtelo bdchtleo bdchtloe
bdchetol bdchetlo bdcheotl bdcheolt bdchelot bdchelto bdchlteo bdchltoe bdchleto bdchleot bdchloet
bdchlote bdceohtl bdceohlt bdceothl bdceotlh bdceolth bdceolht bdcehotl bdceholt bdcehtol bdcehtlo
bdcehlto bdcehlot bdcethol bdcethlo bdcetohl bdcetolh bdcetloh bdcetlho bdcelhto bdcelhot bdceltho
bdceltoh bdceloth bdceloht bdclohet bdclohte bdcloeht bdcloeth bdcloteh bdclothe bdclhoet bdclhote
bdclheot bdclheto bdclhteo bdclhtoe bdclehot bdclehto bdcleoht bdcleoth bdcletoh bdcletho bdcltheo
bdclthoe bdclteho bdclteoh bdcltoeh bdcltohe bdhtcoel bdhtcole bdhtceol bdhtcelo bdhtcleo bdhtcloe
bdhtocel bdhtocle bdhtoecl bdhtoelc bdhtolec bdhtolce bdhteocl bdhteolc bdhtecol bdhteclo bdhtelco
bdhteloc bdhtloec bdhtloce bdhtleoc bdhtleco bdhtlceo bdhtlcoe bdhctoel bdhctole bdhcteol bdhctelo
bdhctleo bdhctloe bdhcotel bdhcotle bdhcoetl bdhcoelt bdhcolet bdhcolte bdhceotl bdhceolt bdhcetol
bdhcetlo bdhcelto bdhcelot bdhcloet bdhclote bdhcleot bdhcleto bdhclteo bdhcltoe bdhoctel bdhoctle
bdhocetl bdhocelt bdhoclet bdhoclte bdhotcel bdhotcle bdhotecl bdhotelc bdhotlec bdhotlce bdhoetcl
bdhoetlc bdhoectl bdhoeclt bdhoelct bdhoeltc bdholtec bdholtce bdholetc bdholect bdholcet bdholcte
bdhecotl bdhecolt bdhectol bdhectlo bdheclto bdheclot bdheoctl bdheoclt bdheotcl bdheotlc bdheoltc
bdheolct bdhetocl bdhetolc bdhetcol bdhetclo bdhetlco bdhetloc bdhelotc bdheloct bdheltoc bdheltco
bdhelcto bdhelcot bdhlcoet bdhlcote bdhlceot bdhlceto bdhlcteo bdhlctoe bdhlocet bdhlocte bdhloect
bdhloetc bdhlotec bdhlotce bdhleoct bdhleotc bdhlecot bdhlecto bdhletco bdhletoc bdhltoec bdhltoce
bdhlteoc bdhlteco bdhltceo bdhltcoe bdetchol bdetchlo bdetcohl bdetcolh bdetcloh bdetclho bdethcol
bdethclo bdethocl bdetholc bdethloc bdethlco bdetohcl bdetohlc bdetochl bdetoclh bdetolch bdetolhc
bdetlhoc bdetlhco bdetlohc bdetloch bdetlcoh bdetlcho bdecthol bdecthlo bdectohl bdectolh bdectloh
bdectlho bdechtol bdechtlo bdechotl bdecholt bdechlot bdechlto bdecohtl bdecohlt bdecothl bdecotlh
bdecolth bdecolht bdeclhot bdeclhto bdecloht bdecloth bdecltoh bdecltho bdehctol bdehctlo bdehcotl
bdehcolt bdehclot bdehclto bdehtcol bdehtclo bdehtocl bdehtolc bdehtloc bdehtlco bdehotcl bdehotlc
bdehoctl bdehoclt bdeholct bdeholtc bdehltoc bdehltco bdehlotc bdehloct bdehlcot bdehlcto bdeochtl
bdeochlt bdeocthl bdeoctlh bdeoclth bdeoclht bdeohctl bdeohclt bdeohtcl bdeohtlc bdeohltc bdeohlct
bdeothcl bdeothlc bdeotchl bdeotclh bdeotlch bdeotlhc bdeolhtc bdeolhct bdeolthc bdeoltch bdeolcth
bdeolcht bdelchot bdelchto bdelcoht bdelcoth bdelctoh bdelctho bdelhcot bdelhcto bdelhoct bdelhotc
bdelhtoc bdelhtco bdelohct bdelohtc bdelocht bdelocth bdelotch bdelothc bdelthoc bdelthco bdeltohc
bdeltoch bdeltcoh bdeltcho bdltcheo bdltchoe bdltceho bdltceoh bdltcoeh bdltcohe bdlthceo bdlthcoe
bdltheco bdltheoc bdlthoec bdlthoce bdltehco bdltehoc bdltecho bdltecoh bdlteoch bdlteohc bdltohec
bdltohce bdltoehc bdltoech bdltoceh bdltoche bdlctheo bdlcthoe bdlcteho bdlcteoh bdlctoeh bdlctohe
bdlchteo bdlchtoe bdlcheto bdlcheot bdlchoet bdlchote bdlcehto bdlcehot bdlcetho bdlcetoh bdlceoth
bdlceoht bdlcohet bdlcohte bdlcoeht bdlcoeth bdlcoteh bdlcothe bdlhcteo bdlhctoe bdlhceto bdlhceot
bdlhcoet bdlhcote bdlhtceo bdlhtcoe bdlhteco bdlhteoc bdlhtoec bdlhtoce bdlhetco bdlhetoc bdlhecto
bdlhecot bdlheoct bdlheotc bdlhotec bdlhotce bdlhoetc bdlhoect bdlhocet bdlhocte bdlechto bdlechot
bdlectho bdlectoh bdlecoth bdlecoht bdlehcto bdlehcot bdlehtco bdlehtoc bdlehotc bdlehoct bdlethco
bdlethoc bdletcho bdletcoh bdletoch bdletohc bdleohtc bdleohct bdleothc bdleotch bdleocth bdleocht
bdlochet bdlochte bdloceht bdloceth bdlocteh bdlocthe bdlohcet bdlohcte bdlohect bdlohetc bdlohtec
bdlohtce bdloehct bdloehtc bdloecht bdloecth bdloetch bdloethc bdlothec bdlothce bdlotehc bdlotech
bdlotceh bdlotche

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us