easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

albicant

shimmele

riggot

unauthenticated

persoluere

institutique

crackjaw

appellaretisque

tawse

hippurid

askance

boose

semphyra

ineffabilis

aphanophyre

deflectometer

demicannon

hydroseparation


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: bearer
cipher variations:
cfbsfs dgctgt ehduhu fieviv gjfwjw
hkgxkx ilhyly jmizmz knjana lokbob
mplcpc nqmdqd ornere psofsf qtpgtg
ruqhuh svrivi twsjwj uxtkxk vyulyl
wzvmzm xawnan ybxobo zcypcp adzqdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: bearer
Cipher: yvzivi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: bearer
Cipher: AAAAB AABAA AAAAA BAAAA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: bearer
cipher variations:
cfbsfsenbanagvbiviidbqdqklbylymtbgtgqjbwjwsrbere
uzbmzmwhbuhuypbcpcaxbkxkdgctgtfocbobhwcjwjjecrer
lmczmznuchuhrkcxkxtscfsfvacnanxicvivzqcdqdbyclyl
ehduhugpdcpcixdkxkkfdsfsmndanaovdivisldylyutdgtg
wbdoboyjdwjwardereczdmzmfievivhqedqdjyelyllgetgt
noebobpwejwjtmezmzvuehuhxcepcpzkexkxbsefsfdaenan
gjfwjwirferekzfmzmmhfuhuopfcpcqxfkxkunfanawvfivi
ydfqdqalfylyctfgtgebfobohkgxkxjsgfsflagnannigviv
pqgdqdryglylvogbobxwgjwjzegrerbmgzmzdughuhfcgpcp
ilhylykthgtgmbhoboojhwjwqrhereszhmzmwphcpcyxhkxk
afhsfscnhanaevhivigdhqdqjmizmzluihuhncipcppkixkx
rsifsftainanxqidqdzyilylbgitgtdoibobfwijwjheirer
knjanamvjiviodjqdqqljylystjgtgubjoboyrjereazjmzm
chjuhuepjcpcgxjkxkifjsfslokbobnwkjwjpekrerrmkzmz
tukhuhvckpcpzskfsfbaknandikvivfqkdqdhyklyljgktgt
mplcpcoxlkxkqflsfssnlanauvliviwdlqdqatlgtgcblobo
ejlwjwgrlereizlmzmkhluhunqmdqdpymlylrgmtgttombob
vwmjwjxemrerbumhuhdcmpcpfkmxkxhsmfsfjamnanlimviv
ornereqznmzmshnuhuupncpcwxnkxkyfnsfscvniviednqdq
glnylyitngtgkbnobomjnwjwpsofsfraonantiovivvqodqd
xyolylzgotgtdwojwjfeorerhmozmzjuohuhlcopcpnkoxkx
qtpgtgsbpoboujpwjwwrpereyzpmzmahpuhuexpkxkgfpsfs
inpanakvpivimdpqdqolpylyruqhuhtcqpcpvkqxkxxsqfsf
zaqnanbiqvivfyqlylhgqtgtjoqboblwqjwjneqrerpmqzmz
svriviudrqdqwlrylyytrgtgabrobocjrwjwgzrmzmihruhu
kprcpcmxrkxkofrsfsqnranatwsjwjvesrerxmszmzzushuh
bcspcpdksxkxhasnanjisvivlqsdqdnyslylpgstgtrosbob
uxtkxkwftsfsyntanaavtivicdtqdqeltylyibtobokjtwjw
mrtereoztmzmqhtuhusptcpcvyulylxgutgtzoubobbwujwj
deurerfmuzmzjcupcplkuxkxnsufsfpaunanriuvivtqudqd
wzvmzmyhvuhuapvcpccxvkxkefvsfsgnvanakdvqdqmlvyly
otvgtgqbvobosjvwjwurverexawnanziwvivbqwdqddywlyl
fgwtgthowboblewrernmwzmzpuwhuhrcwpcptkwxkxvswfsf
ybxoboajxwjwcrxereezxmzmghxuhuipxcpcmfxsfsonxana
qvxivisdxqdqulxylywtxgtgzcypcpbkyxkxdsyfsffaynan
hiyvivjqydqdngytgtpoybobrwyjwjteyrervmyzmzxuyhuh
adzqdqclzylyetzgtggbzoboijzwjwkrzereohzuhuqpzcpc
sxzkxkufzsfswnzanayvzivibearerdmazmzfuahuhhcapcp
jkaxkxlsafsfpiavivrqadqdtyalylvgatgtxoabobzwajwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: bearer
Cipher: ornere

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: bearer
Cipher: 215111245124

Extended Methods:
Method #1

Plaintext: bearer
method variations:
gkfwkwmplbpbruqgugwzvmzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b e a r e r 
2 5 1 2 5 2 
1 1 1 4 1 4 
They are then read out in rows:
251252111414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: bearer
Cipher: wfkaqq

Read more ...
Method #3

Plaintext: bearer
method variations:
vafyfi afyfiv fyfiva
yfivaf fivafy ivafyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: bearer

all 720 cipher variations:
bearer bearre beaerr beaerr bearer bearre beraer berare berear berera berrea
berrae beerar beerra beearr beearr beerar beerra berrea berrae berera berear
beraer berare baerer baerre baeerr baeerr baerer baerre bareer barere bareer
barere barree barree baerer baerre baeerr baeerr baerer baerre barree barree
barere bareer bareer barere braeer braere braeer braere braree braree breaer
breare breear breera brerea brerae breear breera breaer breare brerae brerea
brreea brreae brreea brreae brraee brraee bearer bearre beaerr beaerr bearer
bearre beraer berare berear berera berrea berrae beerar beerra beearr beearr
beerar beerra berrea berrae berera berear beraer berare braree braree braere
braeer braeer braere brraee brraee brreae brreea brreea brreae brerae brerea
breare breaer breear breera brerea brerae breera breear breaer breare ebarer
ebarre ebaerr ebaerr ebarer ebarre ebraer ebrare ebrear ebrera ebrrea ebrrae
eberar eberra ebearr ebearr eberar eberra ebrrea ebrrae ebrera ebrear ebraer
ebrare eabrer eabrre eaberr eaberr eabrer eabrre earber earbre earebr earerb
earreb earrbe eaerbr eaerrb eaebrr eaebrr eaerbr eaerrb earreb earrbe earerb
earebr earber earbre eraber erabre eraebr eraerb erareb erarbe erbaer erbare
erbear erbera erbrea erbrae erebar erebra ereabr erearb ererab ererba errbea
errbae erreba erreab erraeb errabe eearbr eearrb eeabrr eeabrr eearbr eearrb
eerabr eerarb eerbar eerbra eerrba eerrab eebrar eebrra eebarr eebarr eebrar
eebrra eerrba eerrab eerbra eerbar eerabr eerarb erareb erarbe eraerb eraebr
eraber erabre erraeb errabe erreab erreba errbea errbae ererab ererba erearb
ereabr erebar erebra erbrea erbrae erbera erbear erbaer erbare aebrer aebrre
aeberr aeberr aebrer aebrre aerber aerbre aerebr aererb aerreb aerrbe aeerbr
aeerrb aeebrr aeebrr aeerbr aeerrb aerreb aerrbe aererb aerebr aerber aerbre
aberer aberre abeerr abeerr aberer aberre abreer abrere abreer abrere abrree
abrree aberer aberre abeerr abeerr aberer aberre abrree abrree abrere abreer
abreer abrere arbeer arbere arbeer arbere arbree arbree areber arebre areebr
areerb arereb arerbe areebr areerb areber arebre arerbe arereb arreeb arrebe
arreeb arrebe arrbee arrbee aebrer aebrre aeberr aeberr aebrer aebrre aerber
aerbre aerebr aererb aerreb aerrbe aeerbr aeerrb aeebrr aeebrr aeerbr aeerrb
aerreb aerrbe aererb aerebr aerber aerbre arbree arbree arbere arbeer arbeer
arbere arrbee arrbee arrebe arreeb arreeb arrebe arerbe arereb arebre areber
areebr areerb arereb arerbe areerb areebr areber arebre reaber reabre reaebr
reaerb reareb rearbe rebaer rebare rebear rebera rebrea rebrae reebar reebra
reeabr reearb reerab reerba rerbea rerbae rereba rereab reraeb rerabe raeber
raebre raeebr raeerb raereb raerbe rabeer rabere rabeer rabere rabree rabree
raeber raebre raeebr raeerb raereb raerbe rarbee rarbee rarebe rareeb rareeb
rarebe rbaeer rbaere rbaeer rbaere rbaree rbaree rbeaer rbeare rbeear rbeera
rberea rberae rbeear rbeera rbeaer rbeare rberae rberea rbreea rbreae rbreea
rbreae rbraee rbraee reaber reabre reaebr reaerb reareb rearbe rebaer rebare
rebear rebera rebrea rebrae reebar reebra reeabr reearb reerab reerba rerbea
rerbae rereba rereab reraeb rerabe rrabee rrabee rraebe rraeeb rraeeb rraebe
rrbaee rrbaee rrbeae rrbeea rrbeea rrbeae rrebae rrebea rreabe rreaeb rreeab
rreeba rrebea rrebae rreeba rreeab rreaeb rreabe eearbr eearrb eeabrr eeabrr
eearbr eearrb eerabr eerarb eerbar eerbra eerrba eerrab eebrar eebrra eebarr
eebarr eebrar eebrra eerrba eerrab eerbra eerbar eerabr eerarb eaerbr eaerrb
eaebrr eaebrr eaerbr eaerrb earebr earerb earber earbre earrbe earreb eabrer
eabrre eaberr eaberr eabrer eabrre earrbe earreb earbre earber earebr earerb
eraebr eraerb eraber erabre erarbe erareb ereabr erearb erebar erebra ererba
ererab erbear erbera erbaer erbare erbrae erbrea erreba erreab errbea errbae
errabe erraeb ebarer ebarre ebaerr ebaerr ebarer ebarre ebraer ebrare ebrear
ebrera ebrrea ebrrae eberar eberra ebearr ebearr eberar eberra ebrrea ebrrae
ebrera ebrear ebraer ebrare erarbe erareb erabre eraber eraebr eraerb errabe
erraeb errbae errbea erreba erreab erbrae erbrea erbare erbaer erbear erbera
ererba ererab erebra erebar ereabr erearb reareb rearbe reaerb reaebr reaber
reabre reraeb rerabe rereab rereba rerbea rerbae reerab reerba reearb reeabr
reebar reebra rebrea rebrae rebera rebear rebaer rebare raereb raerbe raeerb
raeebr raeber raebre rareeb rarebe rareeb rarebe rarbee rarbee raereb raerbe
raeerb raeebr raeber raebre rabree rabree rabere rabeer rabeer rabere rraeeb
rraebe rraeeb rraebe rrabee rrabee rreaeb rreabe rreeab rreeba rrebea rrebae
rreeab rreeba rreaeb rreabe rrebae rrebea rrbeea rrbeae rrbeea rrbeae rrbaee
rrbaee reareb rearbe reaerb reaebr reaber reabre reraeb rerabe rereab rereba
rerbea rerbae reerab reerba reearb reeabr reebar reebra rebrea rebrae rebera
rebear rebaer rebare rbaree rbaree rbaere rbaeer rbaeer rbaere rbraee rbraee
rbreae rbreea rbreea rbreae rberae rberea rbeare rbeaer rbeear rbeera rberea
rberae rbeera rbeear rbeaer rbeare

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us