easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

rcole

removalist

overidealism

lirette

mvshost

hypocoristical

pentz

urethrorrhoea

fanatica

lionfishes

subiceresque

tomjohn

iuberemque

sentivitistisque

roussette

anodyne

armik

salinaeque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: barabra
cipher variations:
cbsbcsb dctcdtc edudeud fevefve gfwfgwf
hgxghxg ihyhiyh jizijzi kjajkaj lkbklbk
mlclmcl nmdmndm onenoen pofopfo qpgpqgp
rqhqrhq srirsir tsjstjs utktukt vuluvlu
wvmvwmv xwnwxnw yxoxyox zypyzpy azqzaqz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: barabra
Cipher: yzizyiz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: barabra
Cipher: AAAAB AAAAA BAAAA AAAAA AAAAB BAAAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: barabra
cipher variations:
cbsbcsbebabeabgbibgibibqbiqbkbybkybmbgbmgbqbwbqwbsbebseb
ubmbumbwbubwubybcbycbabkbakbdctcdtcfcbcfbchcjchjcjcrcjrc
lczclzcnchcnhcrcxcrxctcfctfcvcncvncxcvcxvczcdczdcbclcblc
edudeudgdcdgcdidkdikdkdsdksdmdadmadodidoidsdydsydudgdugd
wdodwodydwdywdadedaedcdmdcmdfevefvehedehdejelejleletelte
nebenbepejepjetezetzevehevhexepexpezexezxebefebfedenedne
gfwfgwfifefiefkfmfkmfmfufmufofcfocfqfkfqkfufafuafwfifwif
yfqfyqfafyfayfcfgfcgfefofeofhgxghxgjgfgjfglgnglngngvgnvg
pgdgpdgrglgrlgvgbgvbgxgjgxjgzgrgzrgbgzgbzgdghgdhgfgpgfpg
ihyhiyhkhghkghmhohmohohwhowhqhehqehshmhsmhwhchwchyhkhykh
ahshashchahcahehiheihghqhgqhjizijzilihilhinipinpipixipxi
rifirfitinitnixidixdizilizlibitibtidibidbifijifjihirihri
kjajkajmjijmijojqjoqjqjyjqyjsjgjsgjujojuojyjejyejajmjamj
cjujcujejcjecjgjkjgkjijsjisjlkbklbknkjknjkpkrkprkrkzkrzk
tkhkthkvkpkvpkzkfkzfkbknkbnkdkvkdvkfkdkfdkhklkhlkjktkjtk
mlclmclolkloklqlslqslslalsaluliluilwlqlwqlalglaglclolcol
elwlewlglelgelilmlimlklulkulnmdmndmpmlmplmrmtmrtmtmbmtbm
vmjmvjmxmrmxrmbmhmbhmdmpmdpmfmxmfxmhmfmhfmjmnmjnmlmvmlvm
onenoenqnmnqmnsnunsununcnucnwnknwknynsnysncnincinenqneqn
gnyngyningnignknonkonmnwnmwnpofopforonornotovotvovodovdo
xoloxlozotoztodojodjoforofrohozohzojohojholopolponoxonxo
qpgpqgpspopsopupwpuwpwpepwepypmpympapupaupepkpekpgpspgsp
ipapiapkpipkipmpqpmqpopypoyprqhqrhqtqpqtpqvqxqvxqxqfqxfq
zqnqznqbqvqbvqfqlqflqhqtqhtqjqbqjbqlqjqljqnqrqnrqpqzqpzq
srirsirurqruqrwryrwyryrgrygraroraorcrwrcwrgrmrgmriruriur
krcrkcrmrkrmkrorsrosrqrarqartsjstjsvsrsvrsxszsxzszshszhs
bspsbpsdsxsdxshsnshnsjsvsjvslsdsldsnslsnlspstsptsrsbsrbs
utktuktwtstwstytatyatatitaitctqtcqtetyteytitotiotktwtkwt
mtetmetotmtomtqtutqutstctsctvuluvluxutuxtuzubuzbubujubju
durudrufuzufzujupujpuluxulxunufunfupunupnuruvurvutudutdu
wvmvwmvyvuvyuvavcvacvcvkvckvevsvesvgvavgavkvqvkqvmvyvmyv
ovgvogvqvovqovsvwvswvuvevuevxwnwxnwzwvwzvwbwdwbdwdwlwdlw
fwtwftwhwbwhbwlwrwlrwnwzwnzwpwhwphwrwpwrpwtwxwtxwvwfwvfw
yxoxyoxaxwxawxcxexcexexmxemxgxuxguxixcxicxmxsxmsxoxaxoax
qxixqixsxqxsqxuxyxuyxwxgxwgxzypyzpybyxybxydyfydfyfynyfny
hyvyhvyjydyjdynytyntypybypbyryjyrjytyrytryvyzyvzyxyhyxhy
azqzaqzczyzcyzezgzegzgzozgozizwziwzkzezkezozuzouzqzczqcz
szkzskzuzszuszwzazwazyzizyizbarabradazadzafahafhahapahpa
jaxajxalafalfapavapvaradardatalatlavatavtaxabaxbazajazja

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: barabra
Cipher: onenoen

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: barabra
Cipher: 21112411212411

Extended Methods:
Method #1

Plaintext: barabra
method variations:
gfwfgwfmlblmblrqgqrgqwvmvwmv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b a r a b r a 
2 1 2 1 2 2 1 
1 1 4 1 1 4 1 
They are then read out in rows:
21212211141141
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: barabra
Cipher: bbgaqad

Read more ...
Method #3

Plaintext: barabra
method variations:
afdffdf fdffdfa dffdfaf
ffdfafd fdfafdf dfafdff
fafdffd

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: barabra

all 5040 cipher variations:
barabra barabar bararba bararab baraarb baraabr barbara barbaar barbraa barbraa barbara
barbaar barrbaa barrbaa barraba barraab barraab barraba barabra barabar bararba bararab
baraarb baraabr baarbra baarbar baarrba baarrab baararb baarabr baabrra baabrar baabrra
baabrar baabarr baabarr baarbra baarbar baarrba baarrab baararb baarabr baaabrr baaabrr
baaarbr baaarrb baaarrb baaarbr babarra babarar babarra babarar babaarr babaarr babrara
babraar babrraa babrraa babrara babraar babrraa babrraa babrara babraar babraar babrara
babarra babarar babarra babarar babaarr babaarr barabra barabar bararba bararab baraarb
baraabr barbara barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba barraab
barraab barraba barabra barabar bararba bararab baraarb baraabr baaabrr baaabrr baaarbr
baaarrb baaarrb baaarbr baabarr baabarr baabrar baabrra baabrra baabrar baarbar baarbra
baarabr baararb baarrab baarrba baarbra baarbar baarrba baarrab baararb baarabr braabra
braabar braarba braarab braaarb braaabr brabara brabaar brabraa brabraa brabara brabaar
brarbaa brarbaa braraba braraab braraab braraba braabra braabar braarba braarab braaarb
braaabr braabra braabar braarba braarab braaarb braaabr brabara brabaar brabraa brabraa
brabara brabaar brarbaa brarbaa braraba braraab braraab braraba braabra braabar braarba
braarab braaarb braaabr brbaara brbaaar brbaraa brbaraa brbaara brbaaar brbaara brbaaar
brbaraa brbaraa brbaara brbaaar brbraaa brbraaa brbraaa brbraaa brbraaa brbraaa brbaara
brbaaar brbaraa brbaraa brbaara brbaaar brrabaa brrabaa brraaba brraaab brraaab brraaba
brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrabaa brrabaa brraaba brraaab brraaab
brraaba brrabaa brrabaa brraaba brraaab brraaab brraaba braabra braabar braarba braarab
braaarb braaabr brabara brabaar brabraa brabraa brabara brabaar brarbaa brarbaa braraba
braraab braraab braraba braabra braabar braarba braarab braaarb braaabr barabra barabar
bararba bararab baraarb baraabr barbara barbaar barbraa barbraa barbara barbaar barrbaa
barrbaa barraba barraab barraab barraba barabra barabar bararba bararab baraarb baraabr
baarbra baarbar baarrba baarrab baararb baarabr baabrra baabrar baabrra baabrar baabarr
baabarr baarbra baarbar baarrba baarrab baararb baarabr baaabrr baaabrr baaarbr baaarrb
baaarrb baaarbr babarra babarar babarra babarar babaarr babaarr babrara babraar babrraa
babrraa babrara babraar babrraa babrraa babrara babraar babraar babrara babarra babarar
babarra babarar babaarr babaarr barabra barabar bararba bararab baraarb baraabr barbara
barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba barraab barraab barraba
barabra barabar bararba bararab baraarb baraabr baaabrr baaabrr baaarbr baaarrb baaarrb
baaarbr baabarr baabarr baabrar baabrra baabrra baabrar baarbar baarbra baarabr baararb
baarrab baarrba baarbra baarbar baarrba baarrab baararb baarabr bbraara bbraaar bbraraa
bbraraa bbraara bbraaar bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbrraaa bbrraaa
bbrraaa bbrraaa bbrraaa bbrraaa bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbarara
bbaraar bbarraa bbarraa bbarara bbaraar bbaarra bbaarar bbaarra bbaarar bbaaarr bbaaarr
bbarara bbaraar bbarraa bbarraa bbarara bbaraar bbaaarr bbaaarr bbaarar bbaarra bbaarra
bbaarar bbaarra bbaarar bbaarra bbaarar bbaaarr bbaaarr bbarara bbaraar bbarraa bbarraa
bbarara bbaraar bbarraa bbarraa bbarara bbaraar bbaraar bbarara bbaarra bbaarar bbaarra
bbaarar bbaaarr bbaaarr bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbraara bbraaar
bbraraa bbraraa bbraara bbraaar bbrraaa bbrraaa bbrraaa bbrraaa bbrraaa bbrraaa bbraara
bbraaar bbraraa bbraraa bbraara bbraaar bbaaarr bbaaarr bbaarar bbaarra bbaarra bbaarar
bbaaarr bbaaarr bbaarar bbaarra bbaarra bbaarar bbaraar bbarara bbaraar bbarara bbarraa
bbarraa bbarara bbaraar bbarraa bbarraa bbarara bbaraar brrabaa brrabaa brraaba brraaab
brraaab brraaba brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrabaa brrabaa brraaba
brraaab brraaab brraaba brrabaa brrabaa brraaba brraaab brraaab brraaba brarbaa brarbaa
braraba braraab braraab braraba brabraa brabraa brabara brabaar brabaar brabara braabra
braabar braarba braarab braaarb braaabr braabar braabra braaabr braaarb braarab braarba
brbaraa brbaraa brbaara brbaaar brbaaar brbaara brbraaa brbraaa brbraaa brbraaa brbraaa
brbraaa brbaraa brbaraa brbaara brbaaar brbaaar brbaara brbaraa brbaraa brbaara brbaaar
brbaaar brbaara braabra braabar braarba braarab braaarb braaabr brabara brabaar brabraa
brabraa brabara brabaar brarbaa brarbaa braraba braraab braraab braraba braabra braabar
braarba braarab braaarb braaabr braabar braabra braaabr braaarb braarab braarba brabaar
brabara brabaar brabara brabraa brabraa braabar braabra braaabr braaarb braarab braarba
brarbaa brarbaa braraba braraab braraab braraba barabra barabar bararba bararab baraarb
baraabr barbara barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba barraab
barraab barraba barabra barabar bararba bararab baraarb baraabr baarbra baarbar baarrba
baarrab baararb baarabr baabrra baabrar baabrra baabrar baabarr baabarr baarbra baarbar
baarrba baarrab baararb baarabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr babarra
babarar babarra babarar babaarr babaarr babrara babraar babrraa babrraa babrara babraar
babrraa babrraa babrara babraar babraar babrara babarra babarar babarra babarar babaarr
babaarr barabra barabar bararba bararab baraarb baraabr barbara barbaar barbraa barbraa
barbara barbaar barrbaa barrbaa barraba barraab barraab barraba barabra barabar bararba
bararab baraarb baraabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr baabarr baabarr
baabrar baabrra baabrra baabrar baarbar baarbra baarabr baararb baarrab baarrba baarbra
baarbar baarrba baarrab baararb baarabr abrabra abrabar abrarba abrarab abraarb abraabr
abrbara abrbaar abrbraa abrbraa abrbara abrbaar abrrbaa abrrbaa abrraba abrraab abrraab
abrraba abrabra abrabar abrarba abrarab abraarb abraabr abarbra abarbar abarrba abarrab
abararb abarabr ababrra ababrar ababrra ababrar ababarr ababarr abarbra abarbar abarrba
abarrab abararb abarabr abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr abbarra abbarar
abbarra abbarar abbaarr abbaarr abbrara abbraar abbrraa abbrraa abbrara abbraar abbrraa
abbrraa abbrara abbraar abbraar abbrara abbarra abbarar abbarra abbarar abbaarr abbaarr
abrabra abrabar abrarba abrarab abraarb abraabr abrbara abrbaar abrbraa abrbraa abrbara
abrbaar abrrbaa abrrbaa abrraba abrraab abrraab abrraba abrabra abrabar abrarba abrarab
abraarb abraabr abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr ababarr ababarr ababrar
ababrra ababrra ababrar abarbar abarbra abarabr abararb abarrab abarrba abarbra abarbar
abarrba abarrab abararb abarabr arbabra arbabar arbarba arbarab arbaarb arbaabr arbbara
arbbaar arbbraa arbbraa arbbara arbbaar arbrbaa arbrbaa arbraba arbraab arbraab arbraba
arbabra arbabar arbarba arbarab arbaarb arbaabr arabbra arabbar arabrba arabrab arabarb
arababr arabbra arabbar arabrba arabrab arabarb arababr ararbba ararbab ararbba ararbab
ararabb ararabb araabrb araabbr araarbb araarbb araabrb araabbr arbabra arbabar arbarba
arbarab arbaarb arbaabr arbbara arbbaar arbbraa arbbraa arbbara arbbaar arbrbaa arbrbaa
arbraba arbraab arbraab arbraba arbabra arbabar arbarba arbarab arbaarb arbaabr arrabba
arrabab arrabba arrabab arraabb arraabb arrbaba arrbaab arrbbaa arrbbaa arrbaba arrbaab
arrbbaa arrbbaa arrbaba arrbaab arrbaab arrbaba arrabba arrabab arrabba arrabab arraabb
arraabb araabrb araabbr araarbb araarbb araabrb araabbr arabarb arababr arabrab arabrba
arabbra arabbar ararbab ararbba ararabb ararabb ararbab ararbba arabbra arabbar arabrba
arabrab arabarb arababr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aarbbra aarbbar
aarbrba aarbrab aarbarb aarbabr aarrbba aarrbab aarrbba aarrbab aarrabb aarrabb aarabrb
aarabbr aararbb aararbb aarabrb aarabbr aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr
aabbrra aabbrar aabbrra aabbrar aabbarr aabbarr aabrbra aabrbar aabrrba aabrrab aabrarb
aabrabr aababrr aababrr aabarbr aabarrb aabarrb aabarbr aabbrra aabbrar aabbrra aabbrar
aabbarr aabbarr aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr aabrrba aabrrab aabrbra
aabrbar aabrabr aabrarb aabarrb aabarbr aabarrb aabarbr aababrr aababrr aarbbra aarbbar
aarbrba aarbrab aarbarb aarbabr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aarrbba
aarrbab aarrbba aarrbab aarrabb aarrabb aarabrb aarabbr aararbb aararbb aarabrb aarabbr
aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb aaabrbr aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb
aaabrbr aaarbbr aaarbrb aaarbbr aaarbrb aaarrbb aaarrbb aaarbrb aaarbbr aaarrbb aaarrbb
aaarbrb aaarbbr abrabra abrabar abrarba abrarab abraarb abraabr abrbara abrbaar abrbraa
abrbraa abrbara abrbaar abrrbaa abrrbaa abrraba abrraab abrraab abrraba abrabra abrabar
abrarba abrarab abraarb abraabr abarbra abarbar abarrba abarrab abararb abarabr ababrra
ababrar ababrra ababrar ababarr ababarr abarbra abarbar abarrba abarrab abararb abarabr
abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr abbarra abbarar abbarra abbarar abbaarr
abbaarr abbrara abbraar abbrraa abbrraa abbrara abbraar abbrraa abbrraa abbrara abbraar
abbraar abbrara abbarra abbarar abbarra abbarar abbaarr abbaarr abrabra abrabar abrarba
abrarab abraarb abraabr abrbara abrbaar abrbraa abrbraa abrbara abrbaar abrrbaa abrrbaa
abrraba abrraab abrraab abrraba abrabra abrabar abrarba abrarab abraarb abraabr abaabrr
abaabrr abaarbr abaarrb abaarrb abaarbr ababarr ababarr ababrar ababrra ababrra ababrar
abarbar abarbra abarabr abararb abarrab abarrba abarbra abarbar abarrba abarrab abararb
abarabr arrabba arrabab arrabba arrabab arraabb arraabb arrbaba arrbaab arrbbaa arrbbaa
arrbaba arrbaab arrbbaa arrbbaa arrbaba arrbaab arrbaab arrbaba arrabba arrabab arrabba
arrabab arraabb arraabb ararbba ararbab ararbba ararbab ararabb ararabb arabrba arabrab
arabbra arabbar arababr arabarb arabbra arabbar arabrba arabrab arabarb arababr araabbr
araabrb araabbr araabrb araarbb araarbb arbarba arbarab arbabra arbabar arbaabr arbaarb
arbraba arbraab arbrbaa arbrbaa arbraba arbraab arbbraa arbbraa arbbara arbbaar arbbaar
arbbara arbarba arbarab arbabra arbabar arbaabr arbaarb arbabra arbabar arbarba arbarab
arbaarb arbaabr arbbara arbbaar arbbraa arbbraa arbbara arbbaar arbrbaa arbrbaa arbraba
arbraab arbraab arbraba arbabra arbabar arbarba arbarab arbaarb arbaabr araabbr araabrb
araabbr araabrb araarbb araarbb arababr arabarb arabbar arabbra arabrba arabrab arabbar
arabbra arababr arabarb arabrab arabrba ararbba ararbab ararbba ararbab ararabb ararabb
aarabrb aarabbr aararbb aararbb aarabrb aarabbr aarbarb aarbabr aarbrab aarbrba aarbbra
aarbbar aarrbab aarrbba aarrabb aarrabb aarrbab aarrbba aarbbra aarbbar aarbrba aarbrab
aarbarb aarbabr aaarbrb aaarbbr aaarrbb aaarrbb aaarbrb aaarbbr aaabrrb aaabrbr aaabrrb
aaabrbr aaabbrr aaabbrr aaarbrb aaarbbr aaarrbb aaarrbb aaarbrb aaarbbr aaabbrr aaabbrr
aaabrbr aaabrrb aaabrrb aaabrbr aabarrb aabarbr aabarrb aabarbr aababrr aababrr aabrarb
aabrabr aabrrab aabrrba aabrbra aabrbar aabrrab aabrrba aabrarb aabrabr aabrbar aabrbra
aabbrra aabbrar aabbrra aabbrar aabbarr aabbarr aarabrb aarabbr aararbb aararbb aarabrb
aarabbr aarbarb aarbabr aarbrab aarbrba aarbbra aarbbar aarrbab aarrbba aarrabb aarrabb
aarrbab aarrbba aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aababrr aababrr aabarbr
aabarrb aabarrb aabarbr aabbarr aabbarr aabbrar aabbrra aabbrra aabbrar aabrbar aabrbra
aabrabr aabrarb aabrrab aabrrba aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr rababra
rababar rabarba rabarab rabaarb rabaabr rabbara rabbaar rabbraa rabbraa rabbara rabbaar
rabrbaa rabrbaa rabraba rabraab rabraab rabraba rababra rababar rabarba rabarab rabaarb
rabaabr raabbra raabbar raabrba raabrab raabarb raababr raabbra raabbar raabrba raabrab
raabarb raababr raarbba raarbab raarbba raarbab raarabb raarabb raaabrb raaabbr raaarbb
raaarbb raaabrb raaabbr rababra rababar rabarba rabarab rabaarb rabaabr rabbara rabbaar
rabbraa rabbraa rabbara rabbaar rabrbaa rabrbaa rabraba rabraab rabraab rabraba rababra
rababar rabarba rabarab rabaarb rabaabr rarabba rarabab rarabba rarabab raraabb raraabb
rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbaab
rarbaba rarabba rarabab rarabba rarabab raraabb raraabb raaabrb raaabbr raaarbb raaarbb
raaabrb raaabbr raabarb raababr raabrab raabrba raabbra raabbar raarbab raarbba raarabb
raarabb raarbab raarbba raabbra raabbar raabrba raabrab raabarb raababr rbaabra rbaabar
rbaarba rbaarab rbaaarb rbaaabr rbabara rbabaar rbabraa rbabraa rbabara rbabaar rbarbaa
rbarbaa rbaraba rbaraab rbaraab rbaraba rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr
rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rbabara rbabaar rbabraa rbabraa rbabara
rbabaar rbarbaa rbarbaa rbaraba rbaraab rbaraab rbaraba rbaabra rbaabar rbaarba rbaarab
rbaaarb rbaaabr rbbaara rbbaaar rbbaraa rbbaraa rbbaara rbbaaar rbbaara rbbaaar rbbaraa
rbbaraa rbbaara rbbaaar rbbraaa rbbraaa rbbraaa rbbraaa rbbraaa rbbraaa rbbaara rbbaaar
rbbaraa rbbaraa rbbaara rbbaaar rbrabaa rbrabaa rbraaba rbraaab rbraaab rbraaba rbrbaaa
rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrabaa rbrabaa rbraaba rbraaab rbraaab rbraaba
rbrabaa rbrabaa rbraaba rbraaab rbraaab rbraaba rbaabra rbaabar rbaarba rbaarab rbaaarb
rbaaabr rbabara rbabaar rbabraa rbabraa rbabara rbabaar rbarbaa rbarbaa rbaraba rbaraab
rbaraab rbaraba rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rababra rababar rabarba
rabarab rabaarb rabaabr rabbara rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa rabrbaa
rabraba rabraab rabraab rabraba rababra rababar rabarba rabarab rabaarb rabaabr raabbra
raabbar raabrba raabrab raabarb raababr raabbra raabbar raabrba raabrab raabarb raababr
raarbba raarbab raarbba raarbab raarabb raarabb raaabrb raaabbr raaarbb raaarbb raaabrb
raaabbr rababra rababar rabarba rabarab rabaarb rabaabr rabbara rabbaar rabbraa rabbraa
rabbara rabbaar rabrbaa rabrbaa rabraba rabraab rabraab rabraba rababra rababar rabarba
rabarab rabaarb rabaabr rarabba rarabab rarabba rarabab raraabb raraabb rarbaba rarbaab
rarbbaa rarbbaa rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbaab rarbaba rarabba
rarabab rarabba rarabab raraabb raraabb raaabrb raaabbr raaarbb raaarbb raaabrb raaabbr
raabarb raababr raabrab raabrba raabbra raabbar raarbab raarbba raarabb raarabb raarbab
raarbba raabbra raabbar raabrba raabrab raabarb raababr rbbaara rbbaaar rbbaraa rbbaraa
rbbaara rbbaaar rbbaara rbbaaar rbbaraa rbbaraa rbbaara rbbaaar rbbraaa rbbraaa rbbraaa
rbbraaa rbbraaa rbbraaa rbbaara rbbaaar rbbaraa rbbaraa rbbaara rbbaaar rbabara rbabaar
rbabraa rbabraa rbabara rbabaar rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rbaraba
rbaraab rbarbaa rbarbaa rbaraba rbaraab rbaaarb rbaaabr rbaarab rbaarba rbaabra rbaabar
rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rbabara rbabaar rbabraa rbabraa rbabara
rbabaar rbarbaa rbarbaa rbaraba rbaraab rbaraab rbaraba rbaabra rbaabar rbaarba rbaarab
rbaaarb rbaaabr rbraaba rbraaab rbrabaa rbrabaa rbraaba rbraaab rbraaba rbraaab rbrabaa
rbrabaa rbraaba rbraaab rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbraaba rbraaab
rbrabaa rbrabaa rbraaba rbraaab rbaaarb rbaaabr rbaarab rbaarba rbaabra rbaabar rbaaarb
rbaaabr rbaarab rbaarba rbaabra rbaabar rbaraab rbaraba rbaraab rbaraba rbarbaa rbarbaa
rbabara rbabaar rbabraa rbabraa rbabara rbabaar rrbabaa rrbabaa rrbaaba rrbaaab rrbaaab
rrbaaba rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbabaa rrbabaa rrbaaba rrbaaab
rrbaaab rrbaaba rrbabaa rrbabaa rrbaaba rrbaaab rrbaaab rrbaaba rrabbaa rrabbaa rrababa
rrabaab rrabaab rrababa rrabbaa rrabbaa rrababa rrabaab rrabaab rrababa rraabba rraabab
rraabba rraabab rraaabb rraaabb rraabab rraabba rraaabb rraaabb rraabab rraabba rrbabaa
rrbabaa rrbaaba rrbaaab rrbaaab rrbaaba rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa
rrbabaa rrbabaa rrbaaba rrbaaab rrbaaab rrbaaba rrbabaa rrbabaa rrbaaba rrbaaab rrbaaab
rrbaaba rraabba rraabab rraabba rraabab rraaabb rraaabb rrababa rrabaab rrabbaa rrabbaa
rrababa rrabaab rrabbaa rrabbaa rrababa rrabaab rrabaab rrababa rraabba rraabab rraabba
rraabab rraaabb rraaabb rraabab rraabba rraaabb rraaabb rraabab rraabba rrabaab rrababa
rrabaab rrababa rrabbaa rrabbaa rraabab rraabba rraaabb rraaabb rraabab rraabba rrabbaa
rrabbaa rrababa rrabaab rrabaab rrababa rababra rababar rabarba rabarab rabaarb rabaabr
rabbara rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa rabrbaa rabraba rabraab rabraab
rabraba rababra rababar rabarba rabarab rabaarb rabaabr raabbra raabbar raabrba raabrab
raabarb raababr raabbra raabbar raabrba raabrab raabarb raababr raarbba raarbab raarbba
raarbab raarabb raarabb raaabrb raaabbr raaarbb raaarbb raaabrb raaabbr rababra rababar
rabarba rabarab rabaarb rabaabr rabbara rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa
rabrbaa rabraba rabraab rabraab rabraba rababra rababar rabarba rabarab rabaarb rabaabr
rarabba rarabab rarabba rarabab raraabb raraabb rarbaba rarbaab rarbbaa rarbbaa rarbaba
rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbaab rarbaba rarabba rarabab rarabba rarabab
raraabb raraabb raaabrb raaabbr raaarbb raaarbb raaabrb raaabbr raabarb raababr raabrab
raabrba raabbra raabbar raarbab raarbba raarabb raarabb raarbab raarbba raabbra raabbar
raabrba raabrab raabarb raababr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aarbbra
aarbbar aarbrba aarbrab aarbarb aarbabr aarrbba aarrbab aarrbba aarrbab aarrabb aarrabb
aarabrb aarabbr aararbb aararbb aarabrb aarabbr aabrbra aabrbar aabrrba aabrrab aabrarb
aabrabr aabbrra aabbrar aabbrra aabbrar aabbarr aabbarr aabrbra aabrbar aabrrba aabrrab
aabrarb aabrabr aababrr aababrr aabarbr aabarrb aabarrb aabarbr aabbrra aabbrar aabbrra
aabbrar aabbarr aabbarr aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr aabrrba aabrrab
aabrbra aabrbar aabrabr aabrarb aabarrb aabarbr aabarrb aabarbr aababrr aababrr aarbbra
aarbbar aarbrba aarbrab aarbarb aarbabr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr
aarrbba aarrbab aarrbba aarrbab aarrabb aarrabb aarabrb aarabbr aararbb aararbb aarabrb
aarabbr aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb aaabrbr aaabbrr aaabbrr aaabrbr aaabrrb
aaabrrb aaabrbr aaarbbr aaarbrb aaarbbr aaarbrb aaarrbb aaarrbb aaarbrb aaarbbr aaarrbb
aaarrbb aaarbrb aaarbbr arabbra arabbar arabrba arabrab arabarb arababr arabbra arabbar
arabrba arabrab arabarb arababr ararbba ararbab ararbba ararbab ararabb ararabb araabrb
araabbr araarbb araarbb araabrb araabbr arbabra arbabar arbarba arbarab arbaarb arbaabr
arbbara arbbaar arbbraa arbbraa arbbara arbbaar arbrbaa arbrbaa arbraba arbraab arbraab
arbraba arbabra arbabar arbarba arbarab arbaarb arbaabr arbbara arbbaar arbbraa arbbraa
arbbara arbbaar arbabra arbabar arbarba arbarab arbaarb arbaabr arbraba arbraab arbrbaa
arbrbaa arbraba arbraab arbaarb arbaabr arbarab arbarba arbabra arbabar arrbbaa arrbbaa
arrbaba arrbaab arrbaab arrbaba arrbbaa arrbbaa arrbaba arrbaab arrbaab arrbaba arrabba
arrabab arrabba arrabab arraabb arraabb arrabab arrabba arraabb arraabb arrabab arrabba
arabbra arabbar arabrba arabrab arabarb arababr arabbra arabbar arabrba arabrab arabarb
arababr ararbba ararbab ararbba ararbab ararabb ararabb araabrb araabbr araarbb araarbb
araabrb araabbr abrabra abrabar abrarba abrarab abraarb abraabr abrbara abrbaar abrbraa
abrbraa abrbara abrbaar abrrbaa abrrbaa abrraba abrraab abrraab abrraba abrabra abrabar
abrarba abrarab abraarb abraabr abarbra abarbar abarrba abarrab abararb abarabr ababrra
ababrar ababrra ababrar ababarr ababarr abarbra abarbar abarrba abarrab abararb abarabr
abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr abbarra abbarar abbarra abbarar abbaarr
abbaarr abbrara abbraar abbrraa abbrraa abbrara abbraar abbrraa abbrraa abbrara abbraar
abbraar abbrara abbarra abbarar abbarra abbarar abbaarr abbaarr abrabra abrabar abrarba
abrarab abraarb abraabr abrbara abrbaar abrbraa abrbraa abrbara abrbaar abrrbaa abrrbaa
abrraba abrraab abrraab abrraba abrabra abrabar abrarba abrarab abraarb abraabr abaabrr
abaabrr abaarbr abaarrb abaarrb abaarbr ababarr ababarr ababrar ababrra ababrra ababrar
abarbar abarbra abarabr abararb abarrab abarrba abarbra abarbar abarrba abarrab abararb
abarabr abrbara abrbaar abrbraa abrbraa abrbara abrbaar abrabra abrabar abrarba abrarab
abraarb abraabr abrraba abrraab abrrbaa abrrbaa abrraba abrraab abraarb abraabr abrarab
abrarba abrabra abrabar abbrara abbraar abbrraa abbrraa abbrara abbraar abbarra abbarar
abbarra abbarar abbaarr abbaarr abbrara abbraar abbrraa abbrraa abbrara abbraar abbaarr
abbaarr abbarar abbarra abbarra abbarar ababrra ababrar ababrra ababrar ababarr ababarr
abarbra abarbar abarrba abarrab abararb abarabr abarrba abarrab abarbra abarbar abarabr
abararb abaarrb abaarbr abaarrb abaarbr abaabrr abaabrr abrbara abrbaar abrbraa abrbraa
abrbara abrbaar abrabra abrabar abrarba abrarab abraarb abraabr abrraba abrraab abrrbaa
abrrbaa abrraba abrraab abraarb abraabr abrarab abrarba abrabra abrabar ababarr ababarr
ababrar ababrra ababrra ababrar abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr abarabr
abararb abarbar abarbra abarrba abarrab abararb abarabr abarrab abarrba abarbra abarbar
arrbbaa arrbbaa arrbaba arrbaab arrbaab arrbaba arrbbaa arrbbaa arrbaba arrbaab arrbaab
arrbaba arrabba arrabab arrabba arrabab arraabb arraabb arrabab arrabba arraabb arraabb
arrabab arrabba arbrbaa arbrbaa arbraba arbraab arbraab arbraba arbbraa arbbraa arbbara
arbbaar arbbaar arbbara arbabra arbabar arbarba arbarab arbaarb arbaabr arbabar arbabra
arbaabr arbaarb arbarab arbarba arbbraa arbbraa arbbara arbbaar arbbaar arbbara arbrbaa
arbrbaa arbraba arbraab arbraab arbraba arbarba arbarab arbabra arbabar arbaabr arbaarb
arbarab arbarba arbaarb arbaabr arbabar arbabra arabbra arabbar arabrba arabrab arabarb
arababr arabbra arabbar arabrba arabrab arabarb arababr ararbba ararbab ararbba ararbab
ararabb ararabb araabrb araabbr araarbb araarbb araabrb araabbr arabbar arabbra arababr
arabarb arabrab arabrba arabbar arabbra arababr arabarb arabrab arabrba araabbr araabrb
araabbr araabrb araarbb araarbb ararbab ararbba ararabb ararabb ararbab ararbba aarbbra
aarbbar aarbrba aarbrab aarbarb aarbabr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr
aarrbba aarrbab aarrbba aarrbab aarrabb aarrabb aarabrb aarabbr aararbb aararbb aarabrb
aarabbr aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr aabbrra aabbrar aabbrra aabbrar
aabbarr aabbarr aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr aababrr aababrr aabarbr
aabarrb aabarrb aabarbr aabbrra aabbrar aabbrra aabbrar aabbarr aabbarr aabrbra aabrbar
aabrrba aabrrab aabrarb aabrabr aabrrba aabrrab aabrbra aabrbar aabrabr aabrarb aabarrb
aabarbr aabarrb aabarbr aababrr aababrr aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr
aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aarrbba aarrbab aarrbba aarrbab aarrabb
aarrabb aarabrb aarabbr aararbb aararbb aarabrb aarabbr aaabbrr aaabbrr aaabrbr aaabrrb
aaabrrb aaabrbr aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb aaabrbr aaarbbr aaarbrb aaarbbr
aaarbrb aaarrbb aaarrbb aaarbrb aaarbbr aaarrbb aaarrbb aaarbrb aaarbbr barabra barabar
bararba bararab baraarb baraabr barbara barbaar barbraa barbraa barbara barbaar barrbaa
barrbaa barraba barraab barraab barraba barabra barabar bararba bararab baraarb baraabr
baarbra baarbar baarrba baarrab baararb baarabr baabrra baabrar baabrra baabrar baabarr
baabarr baarbra baarbar baarrba baarrab baararb baarabr baaabrr baaabrr baaarbr baaarrb
baaarrb baaarbr babarra babarar babarra babarar babaarr babaarr babrara babraar babrraa
babrraa babrara babraar babrraa babrraa babrara babraar babraar babrara babarra babarar
babarra babarar babaarr babaarr barabra barabar bararba bararab baraarb baraabr barbara
barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba barraab barraab barraba
barabra barabar bararba bararab baraarb baraabr baaabrr baaabrr baaarbr baaarrb baaarrb
baaarbr baabarr baabarr baabrar baabrra baabrra baabrar baarbar baarbra baarabr baararb
baarrab baarrba baarbra baarbar baarrba baarrab baararb baarabr braabra braabar braarba
braarab braaarb braaabr brabara brabaar brabraa brabraa brabara brabaar brarbaa brarbaa
braraba braraab braraab braraba braabra braabar braarba braarab braaarb braaabr braabra
braabar braarba braarab braaarb braaabr brabara brabaar brabraa brabraa brabara brabaar
brarbaa brarbaa braraba braraab braraab braraba braabra braabar braarba braarab braaarb
braaabr brbaara brbaaar brbaraa brbaraa brbaara brbaaar brbaara brbaaar brbaraa brbaraa
brbaara brbaaar brbraaa brbraaa brbraaa brbraaa brbraaa brbraaa brbaara brbaaar brbaraa
brbaraa brbaara brbaaar brrabaa brrabaa brraaba brraaab brraaab brraaba brrbaaa brrbaaa
brrbaaa brrbaaa brrbaaa brrbaaa brrabaa brrabaa brraaba brraaab brraaab brraaba brrabaa
brrabaa brraaba brraaab brraaab brraaba braabra braabar braarba braarab braaarb braaabr
brabara brabaar brabraa brabraa brabara brabaar brarbaa brarbaa braraba braraab braraab
braraba braabra braabar braarba braarab braaarb braaabr barabra barabar bararba bararab
baraarb baraabr barbara barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba
barraab barraab barraba barabra barabar bararba bararab baraarb baraabr baarbra baarbar
baarrba baarrab baararb baarabr baabrra baabrar baabrra baabrar baabarr baabarr baarbra
baarbar baarrba baarrab baararb baarabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr
babarra babarar babarra babarar babaarr babaarr babrara babraar babrraa babrraa babrara
babraar babrraa babrraa babrara babraar babraar babrara babarra babarar babarra babarar
babaarr babaarr barabra barabar bararba bararab baraarb baraabr barbara barbaar barbraa
barbraa barbara barbaar barrbaa barrbaa barraba barraab barraab barraba barabra barabar
bararba bararab baraarb baraabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr baabarr
baabarr baabrar baabrra baabrra baabrar baarbar baarbra baarabr baararb baarrab baarrba
baarbra baarbar baarrba baarrab baararb baarabr bbraara bbraaar bbraraa bbraraa bbraara
bbraaar bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbrraaa bbrraaa bbrraaa bbrraaa
bbrraaa bbrraaa bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbarara bbaraar bbarraa
bbarraa bbarara bbaraar bbaarra bbaarar bbaarra bbaarar bbaaarr bbaaarr bbarara bbaraar
bbarraa bbarraa bbarara bbaraar bbaaarr bbaaarr bbaarar bbaarra bbaarra bbaarar bbaarra
bbaarar bbaarra bbaarar bbaaarr bbaaarr bbarara bbaraar bbarraa bbarraa bbarara bbaraar
bbarraa bbarraa bbarara bbaraar bbaraar bbarara bbaarra bbaarar bbaarra bbaarar bbaaarr
bbaaarr bbraara bbraaar bbraraa bbraraa bbraara bbraaar bbraara bbraaar bbraraa bbraraa
bbraara bbraaar bbrraaa bbrraaa bbrraaa bbrraaa bbrraaa bbrraaa bbraara bbraaar bbraraa
bbraraa bbraara bbraaar bbaaarr bbaaarr bbaarar bbaarra bbaarra bbaarar bbaaarr bbaaarr
bbaarar bbaarra bbaarra bbaarar bbaraar bbarara bbaraar bbarara bbarraa bbarraa bbarara
bbaraar bbarraa bbarraa bbarara bbaraar brrabaa brrabaa brraaba brraaab brraaab brraaba
brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrbaaa brrabaa brrabaa brraaba brraaab brraaab
brraaba brrabaa brrabaa brraaba brraaab brraaab brraaba brarbaa brarbaa braraba braraab
braraab braraba brabraa brabraa brabara brabaar brabaar brabara braabra braabar braarba
braarab braaarb braaabr braabar braabra braaabr braaarb braarab braarba brbaraa brbaraa
brbaara brbaaar brbaaar brbaara brbraaa brbraaa brbraaa brbraaa brbraaa brbraaa brbaraa
brbaraa brbaara brbaaar brbaaar brbaara brbaraa brbaraa brbaara brbaaar brbaaar brbaara
braabra braabar braarba braarab braaarb braaabr brabara brabaar brabraa brabraa brabara
brabaar brarbaa brarbaa braraba braraab braraab braraba braabra braabar braarba braarab
braaarb braaabr braabar braabra braaabr braaarb braarab braarba brabaar brabara brabaar
brabara brabraa brabraa braabar braabra braaabr braaarb braarab braarba brarbaa brarbaa
braraba braraab braraab braraba barabra barabar bararba bararab baraarb baraabr barbara
barbaar barbraa barbraa barbara barbaar barrbaa barrbaa barraba barraab barraab barraba
barabra barabar bararba bararab baraarb baraabr baarbra baarbar baarrba baarrab baararb
baarabr baabrra baabrar baabrra baabrar baabarr baabarr baarbra baarbar baarrba baarrab
baararb baarabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr babarra babarar babarra
babarar babaarr babaarr babrara babraar babrraa babrraa babrara babraar babrraa babrraa
babrara babraar babraar babrara babarra babarar babarra babarar babaarr babaarr barabra
barabar bararba bararab baraarb baraabr barbara barbaar barbraa barbraa barbara barbaar
barrbaa barrbaa barraba barraab barraab barraba barabra barabar bararba bararab baraarb
baraabr baaabrr baaabrr baaarbr baaarrb baaarrb baaarbr baabarr baabarr baabrar baabrra
baabrra baabrar baarbar baarbra baarabr baararb baarrab baarrba baarbra baarbar baarrba
baarrab baararb baarabr rarabba rarabab rarabba rarabab raraabb raraabb rarbaba rarbaab
rarbbaa rarbbaa rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbaab rarbaba rarabba
rarabab rarabba rarabab raraabb raraabb raarbba raarbab raarbba raarbab raarabb raarabb
raabrba raabrab raabbra raabbar raababr raabarb raabbra raabbar raabrba raabrab raabarb
raababr raaabbr raaabrb raaabbr raaabrb raaarbb raaarbb rabarba rabarab rababra rababar
rabaabr rabaarb rabraba rabraab rabrbaa rabrbaa rabraba rabraab rabbraa rabbraa rabbara
rabbaar rabbaar rabbara rabarba rabarab rababra rababar rabaabr rabaarb rababra rababar
rabarba rabarab rabaarb rabaabr rabbara rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa
rabrbaa rabraba rabraab rabraab rabraba rababra rababar rabarba rabarab rabaarb rabaabr
raaabbr raaabrb raaabbr raaabrb raaarbb raaarbb raababr raabarb raabbar raabbra raabrba
raabrab raabbar raabbra raababr raabarb raabrab raabrba raarbba raarbab raarbba raarbab
raarabb raarabb rraabba rraabab rraabba rraabab rraaabb rraaabb rrababa rrabaab rrabbaa
rrabbaa rrababa rrabaab rrabbaa rrabbaa rrababa rrabaab rrabaab rrababa rraabba rraabab
rraabba rraabab rraaabb rraaabb rraabba rraabab rraabba rraabab rraaabb rraaabb rrababa
rrabaab rrabbaa rrabbaa rrababa rrabaab rrabbaa rrabbaa rrababa rrabaab rrabaab rrababa
rraabba rraabab rraabba rraabab rraaabb rraaabb rrbaaba rrbaaab rrbabaa rrbabaa rrbaaba
rrbaaab rrbaaba rrbaaab rrbabaa rrbabaa rrbaaba rrbaaab rrbbaaa rrbbaaa rrbbaaa rrbbaaa
rrbbaaa rrbbaaa rrbaaba rrbaaab rrbabaa rrbabaa rrbaaba rrbaaab rrbabaa rrbabaa rrbaaba
rrbaaab rrbaaab rrbaaba rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbbaaa rrbabaa rrbabaa
rrbaaba rrbaaab rrbaaab rrbaaba rrbabaa rrbabaa rrbaaba rrbaaab rrbaaab rrbaaba rraabba
rraabab rraabba rraabab rraaabb rraaabb rrababa rrabaab rrabbaa rrabbaa rrababa rrabaab
rrabbaa rrabbaa rrababa rrabaab rrabaab rrababa rraabba rraabab rraabba rraabab rraaabb
rraaabb rarabba rarabab rarabba rarabab raraabb raraabb rarbaba rarbaab rarbbaa rarbbaa
rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbaab rarbaba rarabba rarabab rarabba
rarabab raraabb raraabb raarbba raarbab raarbba raarbab raarabb raarabb raabrba raabrab
raabbra raabbar raababr raabarb raabbra raabbar raabrba raabrab raabarb raababr raaabbr
raaabrb raaabbr raaabrb raaarbb raaarbb rabarba rabarab rababra rababar rabaabr rabaarb
rabraba rabraab rabrbaa rabrbaa rabraba rabraab rabbraa rabbraa rabbara rabbaar rabbaar
rabbara rabarba rabarab rababra rababar rabaabr rabaarb rababra rababar rabarba rabarab
rabaarb rabaabr rabbara rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa rabrbaa rabraba
rabraab rabraab rabraba rababra rababar rabarba rabarab rabaarb rabaabr raaabbr raaabrb
raaabbr raaabrb raaarbb raaarbb raababr raabarb raabbar raabbra raabrba raabrab raabbar
raabbra raababr raabarb raabrab raabrba raarbba raarbab raarbba raarbab raarabb raarabb
rbraaba rbraaab rbrabaa rbrabaa rbraaba rbraaab rbraaba rbraaab rbrabaa rbrabaa rbraaba
rbraaab rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbraaba rbraaab rbrabaa rbrabaa
rbraaba rbraaab rbaraba rbaraab rbarbaa rbarbaa rbaraba rbaraab rbaarba rbaarab rbaabra
rbaabar rbaaabr rbaaarb rbabara rbabaar rbabraa rbabraa rbabara rbabaar rbaaabr rbaaarb
rbaabar rbaabra rbaarba rbaarab rbaarba rbaarab rbaabra rbaabar rbaaabr rbaaarb rbaraba
rbaraab rbarbaa rbarbaa rbaraba rbaraab rbabraa rbabraa rbabara rbabaar rbabaar rbabara
rbaarba rbaarab rbaabra rbaabar rbaaabr rbaaarb rbbaara rbbaaar rbbaraa rbbaraa rbbaara
rbbaaar rbbaara rbbaaar rbbaraa rbbaraa rbbaara rbbaaar rbbraaa rbbraaa rbbraaa rbbraaa
rbbraaa rbbraaa rbbaara rbbaaar rbbaraa rbbaraa rbbaara rbbaaar rbaaabr rbaaarb rbaabar
rbaabra rbaarba rbaarab rbaaabr rbaaarb rbaabar rbaabra rbaarba rbaarab rbabaar rbabara
rbabaar rbabara rbabraa rbabraa rbaraba rbaraab rbarbaa rbarbaa rbaraba rbaraab rbrabaa
rbrabaa rbraaba rbraaab rbraaab rbraaba rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa rbrbaaa
rbrabaa rbrabaa rbraaba rbraaab rbraaab rbraaba rbrabaa rbrabaa rbraaba rbraaab rbraaab
rbraaba rbarbaa rbarbaa rbaraba rbaraab rbaraab rbaraba rbabraa rbabraa rbabara rbabaar
rbabaar rbabara rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rbaabar rbaabra rbaaabr
rbaaarb rbaarab rbaarba rbbaraa rbbaraa rbbaara rbbaaar rbbaaar rbbaara rbbraaa rbbraaa
rbbraaa rbbraaa rbbraaa rbbraaa rbbaraa rbbaraa rbbaara rbbaaar rbbaaar rbbaara rbbaraa
rbbaraa rbbaara rbbaaar rbbaaar rbbaara rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr
rbabara rbabaar rbabraa rbabraa rbabara rbabaar rbarbaa rbarbaa rbaraba rbaraab rbaraab
rbaraba rbaabra rbaabar rbaarba rbaarab rbaaarb rbaaabr rbaabar rbaabra rbaaabr rbaaarb
rbaarab rbaarba rbabaar rbabara rbabaar rbabara rbabraa rbabraa rbaabar rbaabra rbaaabr
rbaaarb rbaarab rbaarba rbarbaa rbarbaa rbaraba rbaraab rbaraab rbaraba rarabba rarabab
rarabba rarabab raraabb raraabb rarbaba rarbaab rarbbaa rarbbaa rarbaba rarbaab rarbbaa
rarbbaa rarbaba rarbaab rarbaab rarbaba rarabba rarabab rarabba rarabab raraabb raraabb
raarbba raarbab raarbba raarbab raarabb raarabb raabrba raabrab raabbra raabbar raababr
raabarb raabbra raabbar raabrba raabrab raabarb raababr raaabbr raaabrb raaabbr raaabrb
raaarbb raaarbb rabarba rabarab rababra rababar rabaabr rabaarb rabraba rabraab rabrbaa
rabrbaa rabraba rabraab rabbraa rabbraa rabbara rabbaar rabbaar rabbara rabarba rabarab
rababra rababar rabaabr rabaarb rababra rababar rabarba rabarab rabaarb rabaabr rabbara
rabbaar rabbraa rabbraa rabbara rabbaar rabrbaa rabrbaa rabraba rabraab rabraab rabraba
rababra rababar rabarba rabarab rabaarb rabaabr raaabbr raaabrb raaabbr raaabrb raaarbb
raaarbb raababr raabarb raabbar raabbra raabrba raabrab raabbar raabbra raababr raabarb
raabrab raabrba raarbba raarbab raarbba raarbab raarabb raarabb aarabrb aarabbr aararbb
aararbb aarabrb aarabbr aarbarb aarbabr aarbrab aarbrba aarbbra aarbbar aarrbab aarrbba
aarrabb aarrabb aarrbab aarrbba aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aaarbrb
aaarbbr aaarrbb aaarrbb aaarbrb aaarbbr aaabrrb aaabrbr aaabrrb aaabrbr aaabbrr aaabbrr
aaarbrb aaarbbr aaarrbb aaarrbb aaarbrb aaarbbr aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb
aaabrbr aabarrb aabarbr aabarrb aabarbr aababrr aababrr aabrarb aabrabr aabrrab aabrrba
aabrbra aabrbar aabrrab aabrrba aabrarb aabrabr aabrbar aabrbra aabbrra aabbrar aabbrra
aabbrar aabbarr aabbarr aarabrb aarabbr aararbb aararbb aarabrb aarabbr aarbarb aarbabr
aarbrab aarbrba aarbbra aarbbar aarrbab aarrbba aarrabb aarrabb aarrbab aarrbba aarbbra
aarbbar aarbrba aarbrab aarbarb aarbabr aababrr aababrr aabarbr aabarrb aabarrb aabarbr
aabbarr aabbarr aabbrar aabbrra aabbrra aabbrar aabrbar aabrbra aabrabr aabrarb aabrrab
aabrrba aabrbra aabrbar aabrrba aabrrab aabrarb aabrabr araabrb araabbr araarbb araarbb
araabrb araabbr arabarb arababr arabrab arabrba arabbra arabbar ararbab ararbba ararabb
ararabb ararbab ararbba arabbra arabbar arabrba arabrab arabarb arababr araabrb araabbr
araarbb araarbb araabrb araabbr arabarb arababr arabrab arabrba arabbra arabbar ararbab
ararbba ararabb ararabb ararbab ararbba arabbra arabbar arabrba arabrab arabarb arababr
arbaarb arbaabr arbarab arbarba arbabra arbabar arbaarb arbaabr arbarab arbarba arbabra
arbabar arbraab arbraba arbraab arbraba arbrbaa arbrbaa arbbara arbbaar arbbraa arbbraa
arbbara arbbaar arrabab arrabba arraabb arraabb arrabab arrabba arrbaab arrbaba arrbaab
arrbaba arrbbaa arrbbaa arrabab arrabba arraabb arraabb arrabab arrabba arrbbaa arrbbaa
arrbaba arrbaab arrbaab arrbaba arbabra arbabar arbarba arbarab arbaarb arbaabr arbbara
arbbaar arbbraa arbbraa arbbara arbbaar arbrbaa arbrbaa arbraba arbraab arbraab arbraba
arbabra arbabar arbarba arbarab arbaarb arbaabr aarabrb aarabbr aararbb aararbb aarabrb
aarabbr aarbarb aarbabr aarbrab aarbrba aarbbra aarbbar aarrbab aarrbba aarrabb aarrabb
aarrbab aarrbba aarbbra aarbbar aarbrba aarbrab aarbarb aarbabr aaarbrb aaarbbr aaarrbb
aaarrbb aaarbrb aaarbbr aaabrrb aaabrbr aaabrrb aaabrbr aaabbrr aaabbrr aaarbrb aaarbbr
aaarrbb aaarrbb aaarbrb aaarbbr aaabbrr aaabbrr aaabrbr aaabrrb aaabrrb aaabrbr aabarrb
aabarbr aabarrb aabarbr aababrr aababrr aabrarb aabrabr aabrrab aabrrba aabrbra aabrbar
aabrrab aabrrba aabrarb aabrabr aabrbar aabrbra aabbrra aabbrar aabbrra aabbrar aabbarr
aabbarr aarabrb aarabbr aararbb aararbb aarabrb aarabbr aarbarb aarbabr aarbrab aarbrba
aarbbra aarbbar aarrbab aarrbba aarrabb aarrabb aarrbab aarrbba aarbbra aarbbar aarbrba
aarbrab aarbarb aarbabr aababrr aababrr aabarbr aabarrb aabarrb aabarbr aabbarr aabbarr
aabbrar aabbrra aabbrra aabbrar aabrbar aabrbra aabrabr aabrarb aabrrab aabrrba aabrbra
aabrbar aabrrba aabrrab aabrarb aabrabr abraarb abraabr abrarab abrarba abrabra abrabar
abraarb abraabr abrarab abrarba abrabra abrabar abrraab abrraba abrraab abrraba abrrbaa
abrrbaa abrbara abrbaar abrbraa abrbraa abrbara abrbaar abararb abarabr abarrab abarrba
abarbra abarbar abaarrb abaarbr abaarrb abaarbr abaabrr abaabrr abararb abarabr abarrab
abarrba abarbra abarbar ababarr ababarr ababrar ababrra ababrra ababrar abaarrb abaarbr
abaarrb abaarbr abaabrr abaabrr abararb abarabr abarrab abarrba abarbra abarbar abarrab
abarrba abararb abarabr abarbar abarbra ababrra ababrar ababrra ababrar ababarr ababarr
abraarb abraabr abrarab abrarba abrabra abrabar abraarb abraabr abrarab abrarba abrabra
abrabar abrraab abrraba abrraab abrraba abrrbaa abrrbaa abrbara abrbaar abrbraa abrbraa
abrbara abrbaar abbaarr abbaarr abbarar abbarra abbarra abbarar abbaarr abbaarr abbarar
abbarra abbarra abbarar abbraar abbrara abbraar abbrara abbrraa abbrraa abbrara abbraar
abbrraa abbrraa abbrara abbraar arrabab arrabba arraabb arraabb arrabab arrabba arrbaab
arrbaba arrbaab arrbaba arrbbaa arrbbaa arrabab arrabba arraabb arraabb arrabab arrabba
arrbbaa arrbbaa arrbaba arrbaab arrbaab arrbaba ararbab ararbba ararabb ararabb ararbab
ararbba arabrab arabrba arabarb arababr arabbar arabbra araabrb araabbr araarbb araarbb
araabrb araabbr arabbar arabbra arababr arabarb arabrab arabrba arbarab arbarba arbaarb
arbaabr arbabar arbabra arbraab arbraba arbraab arbraba arbrbaa arbrbaa arbarab arbarba
arbaarb arbaabr arbabar arbabra arbbraa arbbraa arbbara arbbaar arbbaar arbbara araabrb
araabbr araarbb araarbb araabrb araabbr arabarb arababr arabrab arabrba arabbra arabbar
ararbab ararbba ararabb ararabb ararbab ararbba arabbra arabbar arabrba arabrab arabarb
arababr arbabar arbabra arbaabr arbaarb arbarab arbarba arbbaar arbbara arbbaar arbbara
arbbraa arbbraa arbabar arbabra arbaabr arbaarb arbarab arbarba arbrbaa arbrbaa arbraba
arbraab arbraab arbraba abrabra abrabar abrarba abrarab abraarb abraabr abrbara abrbaar
abrbraa abrbraa abrbara abrbaar abrrbaa abrrbaa abrraba abrraab abrraab abrraba abrabra
abrabar abrarba abrarab abraarb abraabr abarbra abarbar abarrba abarrab abararb abarabr
ababrra ababrar ababrra ababrar ababarr ababarr abarbra abarbar abarrba abarrab abararb
abarabr abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr abbarra abbarar abbarra abbarar
abbaarr abbaarr abbrara abbraar abbrraa abbrraa abbrara abbraar abbrraa abbrraa abbrara
abbraar abbraar abbrara abbarra abbarar abbarra abbarar abbaarr abbaarr abrabra abrabar
abrarba abrarab abraarb abraabr abrbara abrbaar abrbraa abrbraa abrbara abrbaar abrrbaa
abrrbaa abrraba abrraab abrraab abrraba abrabra abrabar abrarba abrarab abraarb abraabr
abaabrr abaabrr abaarbr abaarrb abaarrb abaarbr ababarr ababarr ababrar ababrra ababrra
ababrar abarbar abarbra abarabr abararb abarrab abarrba abarbra abarbar abarrba abarrab
abararb abarabr

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us