easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

raffee

cogitatio

westtremont

deray

hornworts

demodulated

oxbiter

knuckled

testaremurque

basiliense

resurgere

appliques

impellamque

tawnies

jehovahnissi

jlundquist

superponderant

disunited


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: babenberg
cipher variations:
cbcfocfsh dcdgpdgti edehqehuj fefirfivk gfgjsgjwl
hghkthkxm ihiluilyn jijmvjmzo kjknwknap lkloxlobq
mlmpympcr nmnqznqds onoraoret popsbpsfu qpqtcqtgv
rqrudruhw srsvesvix tstwftwjy utuxguxkz vuvyhvyla
wvwziwzmb xwxajxanc yxybkybod zyzclzcpe azadmadqf

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: babenberg
Cipher: yzyvmyvit

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: babenberg
Cipher: AAAAB AAAAA AAAAB AABAA ABBAA AAAAB AABAA BAAAA AABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: babenberg
cipher variations:
cbcfocfshebenoenatgbgvogvifibidoidqrkbkloklydmbmtomtgpqbqjoqjwnsbsrosrez
ubuzouzmlwbwhowhuxybypoypcjabaxoaxkvdcdgpdgtifcfopfobuhchwphwjgjcjepjers
lclmplmzencnupnuhqrcrkprkxotctsptsfavcvapvanmxcxipxivyzczqpzqdkbcbypbylw
edehqehujgdgpqgpcvidixqixkhkdkfqkfstmdmnqmnafodovqovirsdslqslypudutqutgb
wdwbqwbonydyjqyjwzadarqarelcdczqczmxfefirfivkhehqrhqdwjejyrjylilelgrlgtu
nenornobgpepwrpwjstetmrtmzqvevurvuhcxexcrxcpozezkrzkxabebsrbsfmdedardany
gfgjsgjwlifirsirexkfkzskzmjmfmhsmhuvofopsopchqfqxsqxktufunsunarwfwvswvid
yfydsydqpafalsalybcfctsctgnefebsebozhghkthkxmjgjstjsfylglatlankngnitnivw
pgpqtpqdirgrytryluvgvotvobsxgxwtxwjezgzetzerqbgbmtbmzcdgdutduhofgfctfcpa
ihiluilynkhktuktgzmhmbumbolohojuojwxqhqruqrejshszuszmvwhwpuwpctyhyxuyxkf
ahafuafsrchcnucnadehevuevipghgdugdqbjijmvjmzoliluvluhanincvncpmpipkvpkxy
rirsvrsfktitavtanwxixqvxqduzizyvzylgbibgvbgtsdidovdobefifwvfwjqhihevherc
kjknwknapmjmvwmvibojodwodqnqjqlwqlyzsjstwstglujubwuboxyjyrwyrevajazwazmh
cjchwchutejepwepcfgjgxwgxkrijifwifsdlkloxlobqnknwxnwjcpkpexperorkrmxrmza
tktuxtuhmvkvcxvcpyzkzsxzsfwbkbaxbanidkdixdivufkfqxfqdghkhyxhylsjkjgxjgte
mlmpympcroloxyoxkdqlqfyqfspslsnysnabuluvyuvinwlwdywdqzalatyatgxclcbycboj
elejyejwvglgrygrehilizyizmtklkhykhufnmnqznqdspmpyzpylermrgzrgtqtmtoztobc
vmvwzvwjoxmxezxerabmbuzbuhydmdczdcpkfmfkzfkxwhmhszhsfijmjazjanulmlizlivg
onoraoretqnqzaqzmfsnshashurunupaupcdwnwxawxkpynyfayfsbcncvacvizenedaedql
gnglaglyxinitaitgjknkbakbovmnmjamjwhpopsbpsfurorabrangtotibtivsvovqbvqde
xoxybxylqzozgbzgtcdodwbdwjafofebfermhohmbhmzyjojubjuhklolcblcpwnonkbnkxi
qpqtcqtgvspsbcsbohupujcujwtwpwrcwrefypyzcyzmrapahcahudepexcexkbgpgfcgfsn
ipincinazkpkvckvilmpmdcmdqxopolcolyjrqrudruhwtqtcdtcpivqvkdvkxuxqxsdxsfg
zqzadzansbqbidbivefqfydfylchqhgdhgtojqjodjobalqlwdlwjmnqnednerypqpmdpmzk
srsvesvixurudeudqjwrwlewlyvyryteytgharabeabotcrcjecjwfgrgzegzmdiriheihup
krkpekpcbmrmxemxknorofeofszqrqneqnaltstwftwjyvsvefverkxsxmfxmzwzszufzuhi
bsbcfbcpudsdkfdkxghshafhanejsjifjivqlslqflqdcnsnyfnylopspgfpgtarsrofrobm
utuxguxkzwtwfgwfslytyngynaxatavgavijctcdgcdqvetelgelyhitibgibofktkjgkjwr
mtmrgmredotozgozmpqtqhgqhubstspgspcnvuvyhvylaxuxghxgtmzuzohzobybubwhbwjk
dudehderwfufmhfmzijujchjcpglulkhlkxsnunshnsfepupahpanqrurihrivctutqhtqdo
wvwziwzmbyvyhiyhunavapiapczcvcxicxklevefiefsxgvgnignajkvkdikdqhmvmlimlyt
ovotiotgfqvqbiqborsvsjisjwduvuriurepxwxajxanczwzijzivobwbqjbqdadwdyjdylm
fwfgjfgtyhwhojhobklwlejlerinwnmjnmzupwpujpuhgrwrcjrcpstwtkjtkxevwvsjvsfq
yxybkybodaxajkajwpcxcrkcrebexezkezmngxghkghuzixipkipclmxmfkmfsjoxonkonav
qxqvkqvihsxsdksdqtuxulkulyfwxwtkwtgrzyzclzcpebybklbkxqdydsldsfcfyfalfano
hyhilhivajyjqljqdmnynglngtkpypolpobwryrwlrwjitytelteruvyvmlvmzgxyxulxuhs
azadmadqfczclmclyrezetmetgdgzgbmgbopizijmijwbkzkrmkrenozohmohulqzqpmqpcx
szsxmsxkjuzufmufsvwzwnmwnahyzyvmyvitbabenbergdadmndmzsfafunfuhehahcnhcpq
jajknjkxclalsnlsfopapinpivmrarqnrqdytatyntylkvavgnvgtwxaxonxobizazwnzwju

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: babenberg
Cipher: onoraoret

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: babenberg
Cipher: 211121513321512422

Extended Methods:
Method #1

Plaintext: babenberg
method variations:
gfgksgkwmmlmpxmpbrrqrucrugwwvwzhwzmb

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
b a b e n b e r g 
2 1 2 5 3 2 5 2 2 
1 1 1 1 3 1 1 4 2 
They are then read out in rows:
212532522111131142
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: babenberg
Cipher: bwhkbalai

Read more ...
Method #3

Plaintext: babenberg
method variations:
afvlhvfig fvlhvfiga vlhvfigaf
lhvfigafv hvfigafvl vfigafvlh
figafvlhv igafvlhvf gafvlhvfi

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: babenberg

first 5040 cipher variations(362880 total)
babenberg babenbegr babenbreg babenbrge babenbgre babenbger babenebrg babenebgr babenerbg babenergb babenegrb
babenegbr babenrebg babenregb babenrbeg babenrbge babenrgbe babenrgeb babengerb babengebr babengreb babengrbe
babengbre babengber babebnerg babebnegr babebnreg babebnrge babebngre babebnger babebenrg babebengr babeberng
babebergn babebegrn babebegnr babebreng babebregn babebrneg babebrnge babebrgne babebrgen babebgern babebgenr
babebgren babebgrne babebgnre babebgner babeebnrg babeebngr babeebrng babeebrgn babeebgrn babeebgnr babeenbrg
babeenbgr babeenrbg babeenrgb babeengrb babeengbr babeernbg babeerngb babeerbng babeerbgn babeergbn babeergnb
babeegnrb babeegnbr babeegrnb babeegrbn babeegbrn babeegbnr baberbeng baberbegn baberbneg baberbnge baberbgne
baberbgen baberebng baberebgn baberenbg baberengb baberegnb baberegbn babernebg babernegb babernbeg babernbge
baberngbe baberngeb babergenb babergebn babergneb babergnbe babergbne babergben babegbern babegbenr babegbren
babegbrne babegbnre babegbner babegebrn babegebnr babegerbn babegernb babegenrb babegenbr babegrebn babegrenb
babegrben babegrbne babegrnbe babegrneb babegnerb babegnebr babegnreb babegnrbe babegnbre babegnber babneberg
babnebegr babnebreg babnebrge babnebgre babnebger babneebrg babneebgr babneerbg babneergb babneegrb babneegbr
babnerebg babneregb babnerbeg babnerbge babnergbe babnergeb babnegerb babnegebr babnegreb babnegrbe babnegbre
babnegber babnbeerg babnbeegr babnbereg babnberge babnbegre babnbeger babnbeerg babnbeegr babnbereg babnberge
babnbegre babnbeger babnbreeg babnbrege babnbreeg babnbrege babnbrgee babnbrgee babnbgere babnbgeer babnbgree
babnbgree babnbgere babnbgeer babneberg babnebegr babnebreg babnebrge babnebgre babnebger babneebrg babneebgr
babneerbg babneergb babneegrb babneegbr babnerebg babneregb babnerbeg babnerbge babnergbe babnergeb babnegerb
babnegebr babnegreb babnegrbe babnegbre babnegber babnrbeeg babnrbege babnrbeeg babnrbege babnrbgee babnrbgee
babnrebeg babnrebge babnreebg babnreegb babnregeb babnregbe babnreebg babnreegb babnrebeg babnrebge babnregbe
babnregeb babnrgeeb babnrgebe babnrgeeb babnrgebe babnrgbee babnrgbee babngbere babngbeer babngbree babngbree
babngbere babngbeer babngebre babngeber babngerbe babngereb babngeerb babngeebr babngrebe babngreeb babngrbee
babngrbee babngrebe babngreeb babngeerb babngeebr babngereb babngerbe babngebre babngeber babbneerg babbneegr
babbnereg babbnerge babbnegre babbneger babbneerg babbneegr babbnereg babbnerge babbnegre babbneger babbnreeg
babbnrege babbnreeg babbnrege babbnrgee babbnrgee babbngere babbngeer babbngree babbngree babbngere babbngeer
babbenerg babbenegr babbenreg babbenrge babbengre babbenger babbeenrg babbeengr babbeerng babbeergn babbeegrn
babbeegnr babbereng babberegn babberneg babbernge babbergne babbergen babbegern babbegenr babbegren babbegrne
babbegnre babbegner babbeenrg babbeengr babbeerng babbeergn babbeegrn babbeegnr babbenerg babbenegr babbenreg
babbenrge babbengre babbenger babberneg babbernge babbereng babberegn babbergen babbergne babbegnre babbegner
babbegrne babbegren babbegern babbegenr babbreeng babbreegn babbreneg babbrenge babbregne babbregen babbreeng
babbreegn babbreneg babbrenge babbregne babbregen babbrneeg babbrnege babbrneeg babbrnege babbrngee babbrngee
babbrgene babbrgeen babbrgnee babbrgnee babbrgene babbrgeen babbgeern babbgeenr babbgeren babbgerne babbgenre
babbgener babbgeern babbgeenr babbgeren babbgerne babbgenre babbgener babbgreen babbgrene babbgreen babbgrene
babbgrnee babbgrnee babbgnere babbgneer babbgnree babbgnree babbgnere babbgneer babenberg babenbegr babenbreg
babenbrge babenbgre babenbger babenebrg babenebgr babenerbg babenergb babenegrb babenegbr babenrebg babenregb
babenrbeg babenrbge babenrgbe babenrgeb babengerb babengebr babengreb babengrbe babengbre babengber babebnerg
babebnegr babebnreg babebnrge babebngre babebnger babebenrg babebengr babeberng babebergn babebegrn babebegnr
babebreng babebregn babebrneg babebrnge babebrgne babebrgen babebgern babebgenr babebgren babebgrne babebgnre
babebgner babeebnrg babeebngr babeebrng babeebrgn babeebgrn babeebgnr babeenbrg babeenbgr babeenrbg babeenrgb
babeengrb babeengbr babeernbg babeerngb babeerbng babeerbgn babeergbn babeergnb babeegnrb babeegnbr babeegrnb
babeegrbn babeegbrn babeegbnr baberbeng baberbegn baberbneg baberbnge baberbgne baberbgen baberebng baberebgn
baberenbg baberengb baberegnb baberegbn babernebg babernegb babernbeg babernbge baberngbe baberngeb babergenb
babergebn babergneb babergnbe babergbne babergben babegbern babegbenr babegbren babegbrne babegbnre babegbner
babegebrn babegebnr babegerbn babegernb babegenrb babegenbr babegrebn babegrenb babegrben babegrbne babegrnbe
babegrneb babegnerb babegnebr babegnreb babegnrbe babegnbre babegnber babrnbeeg babrnbege babrnbeeg babrnbege
babrnbgee babrnbgee babrnebeg babrnebge babrneebg babrneegb babrnegeb babrnegbe babrneebg babrneegb babrnebeg
babrnebge babrnegbe babrnegeb babrngeeb babrngebe babrngeeb babrngebe babrngbee babrngbee babrbneeg babrbnege
babrbneeg babrbnege babrbngee babrbngee babrbeneg babrbenge babrbeeng babrbeegn babrbegen babrbegne babrbeeng
babrbeegn babrbeneg babrbenge babrbegne babrbegen babrbgeen babrbgene babrbgeen babrbgene babrbgnee babrbgnee
babrebneg babrebnge babrebeng babrebegn babrebgen babrebgne babrenbeg babrenbge babrenebg babrenegb babrengeb
babrengbe babreenbg babreengb babreebng babreebgn babreegbn babreegnb babregneb babregnbe babregenb babregebn
babregben babregbne babrebeng babrebegn babrebneg babrebnge babrebgne babrebgen babreebng babreebgn babreenbg
babreengb babreegnb babreegbn babrenebg babrenegb babrenbeg babrenbge babrengbe babrengeb babregenb babregebn
babregneb babregnbe babregbne babregben babrgbeen babrgbene babrgbeen babrgbene babrgbnee babrgbnee babrgeben
babrgebne babrgeebn babrgeenb babrgeneb babrgenbe babrgeebn babrgeenb babrgeben babrgebne babrgenbe babrgeneb
babrgneeb babrgnebe babrgneeb babrgnebe babrgnbee babrgnbee babgnbere babgnbeer babgnbree babgnbree babgnbere
babgnbeer babgnebre babgneber babgnerbe babgnereb babgneerb babgneebr babgnrebe babgnreeb babgnrbee babgnrbee
babgnrebe babgnreeb babgneerb babgneebr babgnereb babgnerbe babgnebre babgneber babgbnere babgbneer babgbnree
babgbnree babgbnere babgbneer babgbenre babgbener babgberne babgberen babgbeern babgbeenr babgbrene babgbreen
babgbrnee babgbrnee babgbrene babgbreen babgbeern babgbeenr babgberen babgberne babgbenre babgbener babgebnre
babgebner babgebrne babgebren babgebern babgebenr babgenbre babgenber babgenrbe babgenreb babgenerb babgenebr
babgernbe babgerneb babgerbne babgerben babgerebn babgerenb babgeenrb babgeenbr babgeernb babgeerbn babgeebrn
babgeebnr babgrbene babgrbeen babgrbnee babgrbnee babgrbene babgrbeen babgrebne babgreben babgrenbe babgreneb
babgreenb babgreebn babgrnebe babgrneeb babgrnbee babgrnbee babgrnebe babgrneeb babgreenb babgreebn babgreneb
babgrenbe babgrebne babgreben babgebern babgebenr babgebren babgebrne babgebnre babgebner babgeebrn babgeebnr
babgeerbn babgeernb babgeenrb babgeenbr babgerebn babgerenb babgerben babgerbne babgernbe babgerneb babgenerb
babgenebr babgenreb babgenrbe babgenbre babgenber baebnberg baebnbegr baebnbreg baebnbrge baebnbgre baebnbger
baebnebrg baebnebgr baebnerbg baebnergb baebnegrb baebnegbr baebnrebg baebnregb baebnrbeg baebnrbge baebnrgbe
baebnrgeb baebngerb baebngebr baebngreb baebngrbe baebngbre baebngber baebbnerg baebbnegr baebbnreg baebbnrge
baebbngre baebbnger baebbenrg baebbengr baebberng baebbergn baebbegrn baebbegnr baebbreng baebbregn baebbrneg
baebbrnge baebbrgne baebbrgen baebbgern baebbgenr baebbgren baebbgrne baebbgnre baebbgner baebebnrg baebebngr
baebebrng baebebrgn baebebgrn baebebgnr baebenbrg baebenbgr baebenrbg baebenrgb baebengrb baebengbr baebernbg
baeberngb baeberbng baeberbgn baebergbn baebergnb baebegnrb baebegnbr baebegrnb baebegrbn baebegbrn baebegbnr
baebrbeng baebrbegn baebrbneg baebrbnge baebrbgne baebrbgen baebrebng baebrebgn baebrenbg baebrengb baebregnb
baebregbn baebrnebg baebrnegb baebrnbeg baebrnbge baebrngbe baebrngeb baebrgenb baebrgebn baebrgneb baebrgnbe
baebrgbne baebrgben baebgbern baebgbenr baebgbren baebgbrne baebgbnre baebgbner baebgebrn baebgebnr baebgerbn
baebgernb baebgenrb baebgenbr baebgrebn baebgrenb baebgrben baebgrbne baebgrnbe baebgrneb baebgnerb baebgnebr
baebgnreb baebgnrbe baebgnbre baebgnber baenbberg baenbbegr baenbbreg baenbbrge baenbbgre baenbbger baenbebrg
baenbebgr baenberbg baenbergb baenbegrb baenbegbr baenbrebg baenbregb baenbrbeg baenbrbge baenbrgbe baenbrgeb
baenbgerb baenbgebr baenbgreb baenbgrbe baenbgbre baenbgber baenbberg baenbbegr baenbbreg baenbbrge baenbbgre
baenbbger baenbebrg baenbebgr baenberbg baenbergb baenbegrb baenbegbr baenbrebg baenbregb baenbrbeg baenbrbge
baenbrgbe baenbrgeb baenbgerb baenbgebr baenbgreb baenbgrbe baenbgbre baenbgber baenebbrg baenebbgr baenebrbg
baenebrgb baenebgrb baenebgbr baenebbrg baenebbgr baenebrbg baenebrgb baenebgrb baenebgbr baenerbbg baenerbgb
baenerbbg baenerbgb baenergbb baenergbb baenegbrb baenegbbr baenegrbb baenegrbb baenegbrb baenegbbr baenrbebg
baenrbegb baenrbbeg baenrbbge baenrbgbe baenrbgeb baenrebbg baenrebgb baenrebbg baenrebgb baenregbb baenregbb
baenrbebg baenrbegb baenrbbeg baenrbbge baenrbgbe baenrbgeb baenrgebb baenrgebb baenrgbeb baenrgbbe baenrgbbe
baenrgbeb baengberb baengbebr baengbreb baengbrbe baengbbre baengbber baengebrb baengebbr baengerbb baengerbb
baengebrb baengebbr baengrebb baengrebb baengrbeb baengrbbe baengrbbe baengrbeb baengberb baengbebr baengbreb
baengbrbe baengbbre baengbber baebnberg baebnbegr baebnbreg baebnbrge baebnbgre baebnbger baebnebrg baebnebgr
baebnerbg baebnergb baebnegrb baebnegbr baebnrebg baebnregb baebnrbeg baebnrbge baebnrgbe baebnrgeb baebngerb
baebngebr baebngreb baebngrbe baebngbre baebngber baebbnerg baebbnegr baebbnreg baebbnrge baebbngre baebbnger
baebbenrg baebbengr baebberng baebbergn baebbegrn baebbegnr baebbreng baebbregn baebbrneg baebbrnge baebbrgne
baebbrgen baebbgern baebbgenr baebbgren baebbgrne baebbgnre baebbgner baebebnrg baebebngr baebebrng baebebrgn
baebebgrn baebebgnr baebenbrg baebenbgr baebenrbg baebenrgb baebengrb baebengbr baebernbg baeberngb baeberbng
baeberbgn baebergbn baebergnb baebegnrb baebegnbr baebegrnb baebegrbn baebegbrn baebegbnr baebrbeng baebrbegn
baebrbneg baebrbnge baebrbgne baebrbgen baebrebng baebrebgn baebrenbg baebrengb baebregnb baebregbn baebrnebg
baebrnegb baebrnbeg baebrnbge baebrngbe baebrngeb baebrgenb baebrgebn baebrgneb baebrgnbe baebrgbne baebrgben
baebgbern baebgbenr baebgbren baebgbrne baebgbnre baebgbner baebgebrn baebgebnr baebgerbn baebgernb baebgenrb
baebgenbr baebgrebn baebgrenb baebgrben baebgrbne baebgrnbe baebgrneb baebgnerb baebgnebr baebgnreb baebgnrbe
baebgnbre baebgnber baeenbbrg baeenbbgr baeenbrbg baeenbrgb baeenbgrb baeenbgbr baeenbbrg baeenbbgr baeenbrbg
baeenbrgb baeenbgrb baeenbgbr baeenrbbg baeenrbgb baeenrbbg baeenrbgb baeenrgbb baeenrgbb baeengbrb baeengbbr
baeengrbb baeengrbb baeengbrb baeengbbr baeebnbrg baeebnbgr baeebnrbg baeebnrgb baeebngrb baeebngbr baeebbnrg
baeebbngr baeebbrng baeebbrgn baeebbgrn baeebbgnr baeebrbng baeebrbgn baeebrnbg baeebrngb baeebrgnb baeebrgbn
baeebgbrn baeebgbnr baeebgrbn baeebgrnb baeebgnrb baeebgnbr baeebbnrg baeebbngr baeebbrng baeebbrgn baeebbgrn
baeebbgnr baeebnbrg baeebnbgr baeebnrbg baeebnrgb baeebngrb baeebngbr baeebrnbg baeebrngb baeebrbng baeebrbgn
baeebrgbn baeebrgnb baeebgnrb baeebgnbr baeebgrnb baeebgrbn baeebgbrn baeebgbnr baeerbbng baeerbbgn baeerbnbg
baeerbngb baeerbgnb baeerbgbn baeerbbng baeerbbgn baeerbnbg baeerbngb baeerbgnb baeerbgbn baeernbbg baeernbgb
baeernbbg baeernbgb baeerngbb baeerngbb baeergbnb baeergbbn baeergnbb baeergnbb baeergbnb baeergbbn baeegbbrn
baeegbbnr baeegbrbn baeegbrnb baeegbnrb baeegbnbr baeegbbrn baeegbbnr baeegbrbn baeegbrnb baeegbnrb baeegbnbr
baeegrbbn baeegrbnb baeegrbbn baeegrbnb baeegrnbb baeegrnbb baeegnbrb baeegnbbr baeegnrbb baeegnrbb baeegnbrb
baeegnbbr baernbebg baernbegb baernbbeg baernbbge baernbgbe baernbgeb baernebbg baernebgb baernebbg baernebgb
baernegbb baernegbb baernbebg baernbegb baernbbeg baernbbge baernbgbe baernbgeb baerngebb baerngebb baerngbeb
baerngbbe baerngbbe baerngbeb baerbnebg baerbnegb baerbnbeg baerbnbge baerbngbe baerbngeb baerbenbg baerbengb
baerbebng baerbebgn baerbegbn baerbegnb baerbbeng baerbbegn baerbbneg baerbbnge baerbbgne baerbbgen baerbgebn
baerbgenb baerbgben baerbgbne baerbgnbe baerbgneb baerebnbg baerebngb baerebbng baerebbgn baerebgbn baerebgnb
baerenbbg baerenbgb baerenbbg baerenbgb baerengbb baerengbb baerebnbg baerebngb baerebbng baerebbgn baerebgbn
baerebgnb baeregnbb baeregnbb baeregbnb baeregbbn baeregbbn baeregbnb baerbbeng baerbbegn baerbbneg baerbbnge
baerbbgne baerbbgen baerbebng baerbebgn baerbenbg baerbengb baerbegnb baerbegbn baerbnebg baerbnegb baerbnbeg
baerbnbge baerbngbe baerbngeb baerbgenb baerbgebn baerbgneb baerbgnbe baerbgbne baerbgben baergbebn baergbenb
baergbben baergbbne baergbnbe baergbneb baergebbn baergebnb baergebbn baergebnb baergenbb baergenbb baergbebn
baergbenb baergbben baergbbne baergbnbe baergbneb baergnebb baergnebb baergnbeb baergnbbe baergnbbe baergnbeb
baegnberb baegnbebr baegnbreb baegnbrbe baegnbbre baegnbber baegnebrb baegnebbr baegnerbb baegnerbb baegnebrb
baegnebbr baegnrebb baegnrebb baegnrbeb baegnrbbe baegnrbbe baegnrbeb baegnberb baegnbebr baegnbreb baegnbrbe
baegnbbre baegnbber baegbnerb baegbnebr baegbnreb baegbnrbe baegbnbre baegbnber baegbenrb baegbenbr baegbernb
baegberbn baegbebrn baegbebnr baegbrenb baegbrebn baegbrneb baegbrnbe baegbrbne baegbrben baegbbern baegbbenr
baegbbren baegbbrne baegbbnre baegbbner baegebnrb baegebnbr baegebrnb baegebrbn baegebbrn baegebbnr baegenbrb
baegenbbr baegenrbb baegenrbb baegenbrb baegenbbr baegernbb baegernbb baegerbnb baegerbbn baegerbbn baegerbnb
baegebnrb baegebnbr baegebrnb baegebrbn baegebbrn baegebbnr baegrbenb baegrbebn baegrbneb baegrbnbe baegrbbne
baegrbben baegrebnb baegrebbn baegrenbb baegrenbb baegrebnb baegrebbn baegrnebb baegrnebb baegrnbeb baegrnbbe
baegrnbbe baegrnbeb baegrbenb baegrbebn baegrbneb baegrbnbe baegrbbne baegrbben baegbbern baegbbenr baegbbren
baegbbrne baegbbnre baegbbner baegbebrn baegbebnr baegberbn baegbernb baegbenrb baegbenbr baegbrebn baegbrenb
baegbrben baegbrbne baegbrnbe baegbrneb baegbnerb baegbnebr baegbnreb baegbnrbe baegbnbre baegbnber banebberg
banebbegr banebbreg banebbrge banebbgre banebbger banebebrg banebebgr baneberbg banebergb banebegrb banebegbr
banebrebg banebregb banebrbeg banebrbge banebrgbe banebrgeb banebgerb banebgebr banebgreb banebgrbe banebgbre
banebgber banebberg banebbegr banebbreg banebbrge banebbgre banebbger banebebrg banebebgr baneberbg banebergb
banebegrb banebegbr banebrebg banebregb banebrbeg banebrbge banebrgbe banebrgeb banebgerb banebgebr banebgreb
banebgrbe banebgbre banebgber baneebbrg baneebbgr baneebrbg baneebrgb baneebgrb baneebgbr baneebbrg baneebbgr
baneebrbg baneebrgb baneebgrb baneebgbr baneerbbg baneerbgb baneerbbg baneerbgb baneergbb baneergbb baneegbrb
baneegbbr baneegrbb baneegrbb baneegbrb baneegbbr banerbebg banerbegb banerbbeg banerbbge banerbgbe banerbgeb
banerebbg banerebgb banerebbg banerebgb baneregbb baneregbb banerbebg banerbegb banerbbeg banerbbge banerbgbe
banerbgeb banergebb banergebb banergbeb banergbbe banergbbe banergbeb banegberb banegbebr banegbreb banegbrbe
banegbbre banegbber banegebrb banegebbr banegerbb banegerbb banegebrb banegebbr banegrebb banegrebb banegrbeb
banegrbbe banegrbbe banegrbeb banegberb banegbebr banegbreb banegbrbe banegbbre banegbber banbeberg banbebegr
banbebreg banbebrge banbebgre banbebger banbeebrg banbeebgr banbeerbg banbeergb banbeegrb banbeegbr banberebg
banberegb banberbeg banberbge banbergbe banbergeb banbegerb banbegebr banbegreb banbegrbe banbegbre banbegber
banbbeerg banbbeegr banbbereg banbberge banbbegre banbbeger banbbeerg banbbeegr banbbereg banbberge banbbegre
banbbeger banbbreeg banbbrege banbbreeg banbbrege banbbrgee banbbrgee banbbgere banbbgeer banbbgree banbbgree
banbbgere banbbgeer banbeberg banbebegr banbebreg banbebrge banbebgre banbebger banbeebrg banbeebgr banbeerbg
banbeergb banbeegrb banbeegbr banberebg banberegb banberbeg banberbge banbergbe banbergeb banbegerb banbegebr
banbegreb banbegrbe banbegbre banbegber banbrbeeg banbrbege banbrbeeg banbrbege banbrbgee banbrbgee banbrebeg
banbrebge banbreebg banbreegb banbregeb banbregbe banbreebg banbreegb banbrebeg banbrebge banbregbe banbregeb
banbrgeeb banbrgebe banbrgeeb banbrgebe banbrgbee banbrgbee banbgbere banbgbeer banbgbree banbgbree banbgbere
banbgbeer banbgebre banbgeber banbgerbe banbgereb banbgeerb banbgeebr banbgrebe banbgreeb banbgrbee banbgrbee
banbgrebe banbgreeb banbgeerb banbgeebr banbgereb banbgerbe banbgebre banbgeber banbbeerg banbbeegr banbbereg
banbberge banbbegre banbbeger banbbeerg banbbeegr banbbereg banbberge banbbegre banbbeger banbbreeg banbbrege
banbbreeg banbbrege banbbrgee banbbrgee banbbgere banbbgeer banbbgree banbbgree banbbgere banbbgeer banbeberg
banbebegr banbebreg banbebrge banbebgre banbebger banbeebrg banbeebgr banbeerbg banbeergb banbeegrb banbeegbr
banberebg banberegb banberbeg banberbge banbergbe banbergeb banbegerb banbegebr banbegreb banbegrbe banbegbre
banbegber banbeebrg banbeebgr banbeerbg banbeergb banbeegrb banbeegbr banbeberg banbebegr banbebreg banbebrge
banbebgre banbebger banberbeg banberbge banberebg banberegb banbergeb banbergbe banbegbre banbegber banbegrbe
banbegreb banbegerb banbegebr banbreebg banbreegb banbrebeg banbrebge banbregbe banbregeb banbreebg banbreegb
banbrebeg banbrebge banbregbe banbregeb banbrbeeg banbrbege banbrbeeg banbrbege banbrbgee banbrbgee banbrgebe
banbrgeeb banbrgbee banbrgbee banbrgebe banbrgeeb banbgeerb banbgeebr banbgereb banbgerbe banbgebre banbgeber
banbgeerb banbgeebr banbgereb banbgerbe banbgebre banbgeber banbgreeb banbgrebe banbgreeb banbgrebe banbgrbee
banbgrbee banbgbere banbgbeer banbgbree banbgbree banbgbere banbgbeer banebberg banebbegr banebbreg banebbrge
banebbgre banebbger banebebrg banebebgr baneberbg banebergb banebegrb banebegbr banebrebg banebregb banebrbeg
banebrbge banebrgbe banebrgeb banebgerb banebgebr banebgreb banebgrbe banebgbre banebgber banebberg banebbegr
banebbreg banebbrge banebbgre banebbger banebebrg banebebgr baneberbg banebergb banebegrb banebegbr banebrebg
banebregb banebrbeg banebrbge banebrgbe banebrgeb banebgerb banebgebr banebgreb banebgrbe banebgbre banebgber
baneebbrg baneebbgr baneebrbg baneebrgb baneebgrb baneebgbr baneebbrg baneebbgr baneebrbg baneebrgb baneebgrb
baneebgbr baneerbbg baneerbgb baneerbbg baneerbgb baneergbb baneergbb baneegbrb baneegbbr baneegrbb baneegrbb
baneegbrb baneegbbr banerbebg banerbegb banerbbeg banerbbge banerbgbe banerbgeb banerebbg banerebgb banerebbg
banerebgb baneregbb baneregbb banerbebg banerbegb banerbbeg banerbbge banerbgbe banerbgeb banergebb banergebb
banergbeb banergbbe banergbbe banergbeb banegberb banegbebr banegbreb banegbrbe banegbbre banegbber banegebrb
banegebbr banegerbb banegerbb banegebrb banegebbr banegrebb banegrebb banegrbeb banegrbbe banegrbbe banegrbeb
banegberb banegbebr banegbreb banegbrbe banegbbre banegbber banrbbeeg banrbbege banrbbeeg banrbbege banrbbgee
banrbbgee banrbebeg banrbebge banrbeebg banrbeegb banrbegeb banrbegbe banrbeebg banrbeegb banrbebeg banrbebge
banrbegbe banrbegeb banrbgeeb banrbgebe banrbgeeb banrbgebe banrbgbee banrbgbee banrbbeeg banrbbege banrbbeeg
banrbbege banrbbgee banrbbgee banrbebeg banrbebge banrbeebg banrbeegb banrbegeb banrbegbe banrbeebg banrbeegb
banrbebeg banrbebge banrbegbe banrbegeb banrbgeeb banrbgebe banrbgeeb banrbgebe banrbgbee banrbgbee banrebbeg
banrebbge banrebebg banrebegb banrebgeb banrebgbe banrebbeg banrebbge banrebebg banrebegb banrebgeb banrebgbe
banreebbg banreebgb banreebbg banreebgb banreegbb banreegbb banregbeb banregbbe banregebb banregebb banregbeb
banregbbe banrebebg banrebegb banrebbeg banrebbge banrebgbe banrebgeb banreebbg banreebgb banreebbg banreebgb
banreegbb banreegbb banrebebg banrebegb banrebbeg banrebbge banrebgbe banrebgeb banregebb banregebb banregbeb
banregbbe banregbbe banregbeb banrgbeeb banrgbebe banrgbeeb banrgbebe banrgbbee banrgbbee banrgebeb banrgebbe
banrgeebb banrgeebb banrgebeb banrgebbe banrgeebb banrgeebb banrgebeb banrgebbe banrgebbe banrgebeb banrgbeeb
banrgbebe banrgbeeb banrgbebe banrgbbee banrgbbee bangbbere bangbbeer bangbbree bangbbree bangbbere bangbbeer
bangbebre bangbeber bangberbe bangbereb bangbeerb bangbeebr bangbrebe bangbreeb bangbrbee bangbrbee bangbrebe
bangbreeb bangbeerb bangbeebr bangbereb bangberbe bangbebre bangbeber bangbbere bangbbeer bangbbree bangbbree
bangbbere bangbbeer bangbebre bangbeber bangberbe bangbereb bangbeerb bangbeebr bangbrebe bangbreeb bangbrbee
bangbrbee bangbrebe bangbreeb bangbeerb bangbeebr bangbereb bangberbe bangbebre bangbeber bangebbre bangebber
bangebrbe bangebreb bangeberb bangebebr bangebbre bangebber bangebrbe bangebreb bangeberb bangebebr bangerbbe
bangerbeb bangerbbe bangerbeb bangerebb bangerebb bangeebrb bangeebbr bangeerbb bangeerbb bangeebrb bangeebbr
bangrbebe bangrbeeb bangrbbee bangrbbee bangrbebe bangrbeeb bangrebbe bangrebeb bangrebbe bangrebeb bangreebb
bangreebb bangrbebe bangrbeeb bangrbbee bangrbbee bangrbebe bangrbeeb bangreebb bangreebb bangrebeb bangrebbe
bangrebbe bangrebeb bangeberb bangebebr bangebreb bangebrbe bangebbre bangebber bangeebrb bangeebbr bangeerbb
bangeerbb bangeebrb bangeebbr bangerebb bangerebb bangerbeb bangerbbe bangerbbe bangerbeb bangeberb bangebebr
bangebreb bangebrbe bangebbre bangebber babenberg babenbegr babenbreg babenbrge babenbgre babenbger babenebrg
babenebgr babenerbg babenergb babenegrb babenegbr babenrebg babenregb babenrbeg babenrbge babenrgbe babenrgeb
babengerb babengebr babengreb babengrbe babengbre babengber babebnerg babebnegr babebnreg babebnrge babebngre
babebnger babebenrg babebengr babeberng babebergn babebegrn babebegnr babebreng babebregn babebrneg babebrnge
babebrgne babebrgen babebgern babebgenr babebgren babebgrne babebgnre babebgner babeebnrg babeebngr babeebrng
babeebrgn babeebgrn babeebgnr babeenbrg babeenbgr babeenrbg babeenrgb babeengrb babeengbr babeernbg babeerngb
babeerbng babeerbgn babeergbn babeergnb babeegnrb babeegnbr babeegrnb babeegrbn babeegbrn babeegbnr baberbeng
baberbegn baberbneg baberbnge baberbgne baberbgen baberebng baberebgn baberenbg baberengb baberegnb baberegbn
babernebg babernegb babernbeg babernbge baberngbe baberngeb babergenb babergebn babergneb babergnbe babergbne
babergben babegbern babegbenr babegbren babegbrne babegbnre babegbner babegebrn babegebnr babegerbn babegernb
babegenrb babegenbr babegrebn babegrenb babegrben babegrbne babegrnbe babegrneb babegnerb babegnebr babegnreb
babegnrbe babegnbre babegnber babneberg babnebegr babnebreg babnebrge babnebgre babnebger babneebrg babneebgr
babneerbg babneergb babneegrb babneegbr babnerebg babneregb babnerbeg babnerbge babnergbe babnergeb babnegerb
babnegebr babnegreb babnegrbe babnegbre babnegber babnbeerg babnbeegr babnbereg babnberge babnbegre babnbeger
babnbeerg babnbeegr babnbereg babnberge babnbegre babnbeger babnbreeg babnbrege babnbreeg babnbrege babnbrgee
babnbrgee babnbgere babnbgeer babnbgree babnbgree babnbgere babnbgeer babneberg babnebegr babnebreg babnebrge
babnebgre babnebger babneebrg babneebgr babneerbg babneergb babneegrb babneegbr babnerebg babneregb babnerbeg
babnerbge babnergbe babnergeb babnegerb babnegebr babnegreb babnegrbe babnegbre babnegber babnrbeeg babnrbege
babnrbeeg babnrbege babnrbgee babnrbgee babnrebeg babnrebge babnreebg babnreegb babnregeb babnregbe babnreebg
babnreegb babnrebeg babnrebge babnregbe babnregeb babnrgeeb babnrgebe babnrgeeb babnrgebe babnrgbee babnrgbee
babngbere babngbeer babngbree babngbree babngbere babngbeer babngebre babngeber babngerbe babngereb babngeerb
babngeebr babngrebe babngreeb babngrbee babngrbee babngrebe babngreeb babngeerb babngeebr babngereb babngerbe
babngebre babngeber babbneerg babbneegr babbnereg babbnerge babbnegre babbneger babbneerg babbneegr babbnereg
babbnerge babbnegre babbneger babbnreeg babbnrege babbnreeg babbnrege babbnrgee babbnrgee babbngere babbngeer
babbngree babbngree babbngere babbngeer babbenerg babbenegr babbenreg babbenrge babbengre babbenger babbeenrg
babbeengr babbeerng babbeergn babbeegrn babbeegnr babbereng babberegn babberneg babbernge babbergne babbergen
babbegern babbegenr babbegren babbegrne babbegnre babbegner babbeenrg babbeengr babbeerng babbeergn babbeegrn
babbeegnr babbenerg babbenegr babbenreg babbenrge babbengre babbenger babberneg babbernge babbereng babberegn
babbergen babbergne babbegnre babbegner babbegrne babbegren babbegern babbegenr babbreeng babbreegn babbreneg
babbrenge babbregne babbregen babbreeng babbreegn babbreneg babbrenge babbregne babbregen babbrneeg babbrnege
babbrneeg babbrnege babbrngee babbrngee babbrgene babbrgeen babbrgnee babbrgnee babbrgene babbrgeen babbgeern
babbgeenr babbgeren babbgerne babbgenre babbgener babbgeern babbgeenr babbgeren babbgerne babbgenre babbgener
babbgreen babbgrene babbgreen babbgrene babbgrnee babbgrnee babbgnere babbgneer babbgnree babbgnree babbgnere
babbgneer babenberg babenbegr babenbreg babenbrge babenbgre babenbger babenebrg babenebgr babenerbg babenergb
babenegrb babenegbr babenrebg babenregb babenrbeg babenrbge babenrgbe babenrgeb babengerb babengebr babengreb
babengrbe babengbre babengber babebnerg babebnegr babebnreg babebnrge babebngre babebnger babebenrg babebengr
babeberng babebergn babebegrn babebegnr babebreng babebregn babebrneg babebrnge babebrgne babebrgen babebgern
babebgenr babebgren babebgrne babebgnre babebgner babeebnrg babeebngr babeebrng babeebrgn babeebgrn babeebgnr
babeenbrg babeenbgr babeenrbg babeenrgb babeengrb babeengbr babeernbg babeerngb babeerbng babeerbgn babeergbn
babeergnb babeegnrb babeegnbr babeegrnb babeegrbn babeegbrn babeegbnr baberbeng baberbegn baberbneg baberbnge
baberbgne baberbgen baberebng baberebgn baberenbg baberengb baberegnb baberegbn babernebg babernegb babernbeg
babernbge baberngbe baberngeb babergenb babergebn babergneb babergnbe babergbne babergben babegbern babegbenr
babegbren babegbrne babegbnre babegbner babegebrn babegebnr babegerbn babegernb babegenrb babegenbr babegrebn
babegrenb babegrben babegrbne babegrnbe babegrneb babegnerb babegnebr babegnreb babegnrbe babegnbre babegnber
babrnbeeg babrnbege babrnbeeg babrnbege babrnbgee babrnbgee babrnebeg babrnebge babrneebg babrneegb babrnegeb
babrnegbe babrneebg babrneegb babrnebeg babrnebge babrnegbe babrnegeb babrngeeb babrngebe babrngeeb babrngebe
babrngbee babrngbee babrbneeg babrbnege babrbneeg babrbnege babrbngee babrbngee babrbeneg babrbenge babrbeeng
babrbeegn babrbegen babrbegne babrbeeng babrbeegn babrbeneg babrbenge babrbegne babrbegen babrbgeen babrbgene
babrbgeen babrbgene babrbgnee babrbgnee babrebneg babrebnge babrebeng babrebegn babrebgen babrebgne babrenbeg
babrenbge babrenebg babrenegb babrengeb babrengbe babreenbg babreengb babreebng babreebgn babreegbn babreegnb
babregneb babregnbe babregenb babregebn babregben babregbne babrebeng babrebegn babrebneg babrebnge babrebgne
babrebgen babreebng babreebgn babreenbg babreengb babreegnb babreegbn babrenebg babrenegb babrenbeg babrenbge
babrengbe babrengeb babregenb babregebn babregneb babregnbe babregbne babregben babrgbeen babrgbene babrgbeen
babrgbene babrgbnee babrgbnee babrgeben babrgebne babrgeebn babrgeenb babrgeneb babrgenbe babrgeebn babrgeenb
babrgeben babrgebne babrgenbe babrgeneb babrgneeb babrgnebe babrgneeb babrgnebe babrgnbee babrgnbee babgnbere
babgnbeer babgnbree babgnbree babgnbere babgnbeer babgnebre babgneber babgnerbe babgnereb babgneerb babgneebr
babgnrebe babgnreeb babgnrbee babgnrbee babgnrebe babgnreeb babgneerb babgneebr babgnereb babgnerbe babgnebre
babgneber babgbnere babgbneer babgbnree babgbnree babgbnere babgbneer babgbenre babgbener babgberne babgberen
babgbeern babgbeenr babgbrene babgbreen babgbrnee babgbrnee babgbrene babgbreen babgbeern babgbeenr babgberen
babgberne babgbenre babgbener babgebnre babgebner babgebrne babgebren babgebern babgebenr babgenbre babgenber
babgenrbe babgenreb babgenerb babgenebr babgernbe babgerneb babgerbne babgerben babgerebn babgerenb babgeenrb
babgeenbr babgeernb babgeerbn babgeebrn babgeebnr babgrbene babgrbeen babgrbnee babgrbnee babgrbene babgrbeen
babgrebne babgreben babgrenbe babgreneb babgreenb babgreebn babgrnebe babgrneeb babgrnbee babgrnbee babgrnebe
babgrneeb babgreenb babgreebn babgreneb babgrenbe babgrebne babgreben babgebern babgebenr babgebren babgebrne
babgebnre babgebner babgeebrn babgeebnr babgeerbn babgeernb babgeenrb babgeenbr babgerebn babgerenb babgerben
babgerbne babgernbe babgerneb babgenerb babgenebr babgenreb babgenrbe babgenbre babgenber baeenbbrg baeenbbgr
baeenbrbg baeenbrgb baeenbgrb baeenbgbr baeenbbrg baeenbbgr baeenbrbg baeenbrgb baeenbgrb baeenbgbr baeenrbbg
baeenrbgb baeenrbbg baeenrbgb baeenrgbb baeenrgbb baeengbrb baeengbbr baeengrbb baeengrbb baeengbrb baeengbbr
baeebnbrg baeebnbgr baeebnrbg baeebnrgb baeebngrb baeebngbr baeebbnrg baeebbngr baeebbrng baeebbrgn baeebbgrn
baeebbgnr baeebrbng baeebrbgn baeebrnbg baeebrngb baeebrgnb baeebrgbn baeebgbrn baeebgbnr baeebgrbn baeebgrnb
baeebgnrb baeebgnbr baeebbnrg baeebbngr baeebbrng baeebbrgn baeebbgrn baeebbgnr baeebnbrg baeebnbgr baeebnrbg
baeebnrgb baeebngrb baeebngbr baeebrnbg baeebrngb baeebrbng baeebrbgn baeebrgbn baeebrgnb baeebgnrb baeebgnbr
baeebgrnb baeebgrbn baeebgbrn baeebgbnr baeerbbng baeerbbgn baeerbnbg baeerbngb baeerbgnb baeerbgbn baeerbbng
baeerbbgn baeerbnbg baeerbngb baeerbgnb baeerbgbn baeernbbg baeernbgb baeernbbg baeernbgb baeerngbb baeerngbb
baeergbnb baeergbbn baeergnbb baeergnbb baeergbnb baeergbbn baeegbbrn baeegbbnr baeegbrbn baeegbrnb baeegbnrb
baeegbnbr baeegbbrn baeegbbnr baeegbrbn baeegbrnb baeegbnrb baeegbnbr baeegrbbn baeegrbnb baeegrbbn baeegrbnb
baeegrnbb baeegrnbb baeegnbrb baeegnbbr baeegnrbb baeegnrbb baeegnbrb baeegnbbr baenebbrg baenebbgr baenebrbg
baenebrgb baenebgrb baenebgbr baenebbrg baenebbgr baenebrbg baenebrgb baenebgrb baenebgbr baenerbbg baenerbgb
baenerbbg baenerbgb baenergbb baenergbb baenegbrb baenegbbr baenegrbb baenegrbb baenegbrb baenegbbr baenbebrg
baenbebgr baenberbg baenbergb baenbegrb baenbegbr baenbberg baenbbegr baenbbreg baenbbrge baenbbgre baenbbger
baenbrbeg baenbrbge baenbrebg baenbregb baenbrgeb baenbrgbe baenbgbre baenbgber baenbgrbe baenbgreb baenbgerb
baenbgebr baenbberg baenbbegr baenbbreg baenbbrge baenbbgre baenbbger baenbebrg baenbebgr baenberbg baenbergb
baenbegrb baenbegbr baenbrebg baenbregb baenbrbeg baenbrbge baenbrgbe baenbrgeb baenbgerb baenbgebr baenbgreb
baenbgrbe baenbgbre baenbgber baenrbbeg baenrbbge baenrbebg baenrbegb baenrbgeb baenrbgbe baenrbbeg baenrbbge
baenrbebg baenrbegb baenrbgeb baenrbgbe baenrebbg baenrebgb baenrebbg baenrebgb baenregbb baenregbb baenrgbeb
baenrgbbe baenrgebb baenrgebb baenrgbeb baenrgbbe baengbbre baengbber baengbrbe baengbreb baengberb baengbebr
baengbbre baengbber baengbrbe baengbreb baengberb baengbebr baengrbbe baengrbeb baengrbbe baengrbeb baengrebb
baengrebb baengebrb baengebbr baengerbb baengerbb baengebrb baengebbr baebnebrg baebnebgr baebnerbg baebnergb
baebnegrb baebnegbr baebnberg baebnbegr baebnbreg baebnbrge baebnbgre baebnbger baebnrbeg baebnrbge baebnrebg
baebnregb baebnrgeb baebnrgbe baebngbre baebngber baebngrbe baebngreb baebngerb baebngebr baebenbrg baebenbgr
baebenrbg baebenrgb baebengrb baebengbr baebebnrg baebebngr baebebrng baebebrgn baebebgrn baebebgnr baeberbng
baeberbgn baebernbg baeberngb baebergnb baebergbn baebegbrn baebegbnr baebegrbn baebegrnb baebegnrb baebegnbr
baebbenrg baebbengr baebberng baebbergn baebbegrn baebbegnr baebbnerg baebbnegr baebbnreg baebbnrge baebbngre
baebbnger baebbrneg baebbrnge baebbreng baebbregn baebbrgen baebbrgne baebbgnre baebbgner baebbgrne baebbgren
baebbgern baebbgenr baebrebng baebrebgn baebrenbg baebrengb baebregnb baebregbn baebrbeng baebrbegn baebrbneg
baebrbnge baebrbgne baebrbgen baebrnbeg baebrnbge baebrnebg baebrnegb baebrngeb baebrngbe baebrgbne baebrgben
baebrgnbe baebrgneb baebrgenb baebrgebn baebgebrn baebgebnr baebgerbn baebgernb baebgenrb baebgenbr baebgbern
baebgbenr baebgbren baebgbrne baebgbnre baebgbner baebgrben baebgrbne baebgrebn baebgrenb baebgrneb baebgrnbe
baebgnbre baebgnber baebgnrbe baebgnreb baebgnerb baebgnebr baebnberg baebnbegr baebnbreg baebnbrge baebnbgre
baebnbger baebnebrg baebnebgr baebnerbg baebnergb baebnegrb baebnegbr baebnrebg baebnregb baebnrbeg baebnrbge
baebnrgbe baebnrgeb baebngerb baebngebr baebngreb baebngrbe baebngbre baebngber baebbnerg baebbnegr baebbnreg
baebbnrge baebbngre baebbnger baebbenrg baebbengr baebberng baebbergn baebbegrn baebbegnr baebbreng baebbregn
baebbrneg baebbrnge baebbrgne baebbrgen baebbgern baebbgenr baebbgren baebbgrne baebbgnre baebbgner baebebnrg
baebebngr baebebrng baebebrgn baebebgrn baebebgnr baebenbrg baebenbgr baebenrbg baebenrgb baebengrb baebengbr
baebernbg baeberngb baeberbng baeberbgn baebergbn baebergnb baebegnrb baebegnbr baebegrnb baebegrbn baebegbrn
baebegbnr baebrbeng baebrbegn baebrbneg baebrbnge baebrbgne baebrbgen baebrebng baebrebgn baebrenbg baebrengb
baebregnb baebregbn baebrnebg baebrnegb baebrnbeg baebrnbge baebrngbe baebrngeb baebrgenb baebrgebn baebrgneb
baebrgnbe baebrgbne baebrgben baebgbern baebgbenr baebgbren baebgbrne baebgbnre baebgbner baebgebrn baebgebnr
baebgerbn baebgernb baebgenrb baebgenbr baebgrebn baebgrenb baebgrben baebgrbne baebgrnbe baebgrneb baebgnerb
baebgnebr baebgnreb baebgnrbe baebgnbre baebgnber baernbbeg baernbbge baernbebg baernbegb baernbgeb baernbgbe
baernbbeg baernbbge baernbebg baernbegb baernbgeb baernbgbe baernebbg baernebgb baernebbg baernebgb baernegbb
baernegbb baerngbeb baerngbbe baerngebb baerngebb baerngbeb baerngbbe baerbnbeg baerbnbge baerbnebg baerbnegb
baerbngeb baerbngbe baerbbneg baerbbnge baerbbeng baerbbegn baerbbgen baerbbgne baerbebng baerbebgn baerbenbg
baerbengb baerbegnb baerbegbn baerbgben baerbgbne baerbgebn baerbgenb baerbgneb baerbgnbe baerbbneg baerbbnge
baerbbeng baerbbegn baerbbgen baerbbgne baerbnbeg baerbnbge baerbnebg baerbnegb baerbngeb baerbngbe baerbenbg
baerbengb baerbebng baerbebgn baerbegbn baerbegnb baerbgneb baerbgnbe baerbgenb baerbgebn baerbgben baerbgbne
baerebbng baerebbgn baerebnbg baerebngb baerebgnb baerebgbn baerebbng baerebbgn baerebnbg baerebngb baerebgnb
baerebgbn baerenbbg baerenbgb baerenbbg baerenbgb baerengbb baerengbb baeregbnb baeregbbn baeregnbb baeregnbb
baeregbnb baeregbbn baergbben baergbbne baergbebn baergbenb baergbneb baergbnbe baergbben baergbbne baergbebn
baergbenb baergbneb baergbnbe baergebbn baergebnb baergebbn baergebnb baergenbb baergenbb baergnbeb baergnbbe
baergnebb baergnebb baergnbeb baergnbbe baegnbbre baegnbber baegnbrbe baegnbreb baegnberb baegnbebr baegnbbre
baegnbber baegnbrbe baegnbreb baegnberb baegnbebr baegnrbbe baegnrbeb baegnrbbe baegnrbeb baegnrebb baegnrebb
baegnebrb baegnebbr baegnerbb baegnerbb baegnebrb baegnebbr baegbnbre baegbnber baegbnrbe baegbnreb baegbnerb
baegbnebr baegbbnre baegbbner baegbbrne baegbbren baegbbern baegbbenr baegbrbne baegbrben baegbrnbe baegbrneb
baegbrenb baegbrebn baegbebrn baegbebnr baegberbn baegbernb baegbenrb baegbenbr baegbbnre baegbbner baegbbrne
baegbbren baegbbern baegbbenr baegbnbre baegbnber baegbnrbe baegbnreb baegbnerb baegbnebr baegbrnbe baegbrneb
baegbrbne baegbrben baegbrebn baegbrenb baegbenrb baegbenbr baegbernb baegberbn baegbebrn baegbebnr baegrbbne
baegrbben baegrbnbe baegrbneb baegrbenb baegrbebn baegrbbne baegrbben baegrbnbe baegrbneb baegrbenb baegrbebn
baegrnbbe baegrnbeb baegrnbbe baegrnbeb baegrnebb baegrnebb baegrebnb baegrebbn baegrenbb baegrenbb baegrebnb
baegrebbn baegebbrn baegebbnr baegebrbn baegebrnb baegebnrb baegebnbr baegebbrn baegebbnr baegebrbn baegebrnb
baegebnrb baegebnbr baegerbbn baegerbnb baegerbbn baegerbnb baegernbb baegernbb baegenbrb baegenbbr baegenrbb
baegenrbb baegenbrb baegenbbr barenbebg barenbegb barenbbeg barenbbge barenbgbe barenbgeb barenebbg barenebgb
barenebbg barenebgb barenegbb barenegbb barenbebg barenbegb barenbbeg barenbbge barenbgbe barenbgeb barengebb
barengebb barengbeb barengbbe barengbbe barengbeb barebnebg barebnegb barebnbeg barebnbge barebngbe barebngeb
barebenbg barebengb barebebng barebebgn barebegbn barebegnb barebbeng barebbegn barebbneg barebbnge barebbgne
barebbgen barebgebn barebgenb barebgben barebgbne barebgnbe barebgneb bareebnbg bareebngb bareebbng bareebbgn
bareebgbn bareebgnb bareenbbg bareenbgb bareenbbg bareenbgb bareengbb bareengbb bareebnbg bareebngb bareebbng
bareebbgn bareebgbn bareebgnb bareegnbb bareegnbb bareegbnb bareegbbn bareegbbn bareegbnb barebbeng barebbegn
barebbneg barebbnge barebbgne barebbgen barebebng barebebgn barebenbg barebengb barebegnb barebegbn barebnebg
barebnegb barebnbeg barebnbge barebngbe barebngeb barebgenb barebgebn barebgneb barebgnbe barebgbne barebgben
baregbebn baregbenb baregbben baregbbne baregbnbe baregbneb baregebbn baregebnb baregebbn baregebnb baregenbb
baregenbb baregbebn baregbenb baregbben baregbbne baregbnbe baregbneb baregnebb baregnebb baregnbeb baregnbbe
baregnbbe baregnbeb barnebebg barnebegb barnebbeg barnebbge barnebgbe barnebgeb barneebbg barneebgb barneebbg
barneebgb barneegbb barneegbb barnebebg barnebegb barnebbeg barnebbge barnebgbe barnebgeb barnegebb barnegebb
barnegbeb barnegbbe barnegbbe barnegbeb barnbeebg barnbeegb barnbebeg barnbebge barnbegbe barnbegeb barnbeebg
barnbeegb barnbebeg barnbebge barnbegbe barnbegeb barnbbeeg barnbbege barnbbeeg barnbbege barnbbgee barnbbgee
barnbgebe barnbgeeb barnbgbee barnbgbee barnbgebe barnbgeeb barnebebg barnebegb barnebbeg barnebbge barnebgbe
barnebgeb barneebbg barneebgb barneebbg barneebgb barneegbb barneegbb barnebebg barnebegb barnebbeg barnebbge
barnebgbe barnebgeb barnegebb barnegebb barnegbeb barnegbbe barnegbbe barnegbeb barnbbeeg barnbbege barnbbeeg
barnbbege barnbbgee barnbbgee barnbebeg barnbebge barnbeebg barnbeegb barnbegeb barnbegbe barnbeebg barnbeegb
barnbebeg barnbebge barnbegbe barnbegeb barnbgeeb barnbgebe barnbgeeb barnbgebe barnbgbee barnbgbee barngbebe
barngbeeb barngbbee barngbbee barngbebe barngbeeb barngebbe barngebeb barngebbe barngebeb barngeebb barngeebb
barngbebe barngbeeb barngbbee barngbbee barngbebe barngbeeb barngeebb barngeebb barngebeb barngebbe barngebbe
barngebeb barbneebg barbneegb barbnebeg barbnebge barbnegbe barbnegeb barbneebg barbneegb barbnebeg barbnebge
barbnegbe barbnegeb barbnbeeg barbnbege barbnbeeg barbnbege barbnbgee barbnbgee barbngebe barbngeeb barbngbee
barbngbee barbngebe barbngeeb barbenebg barbenegb barbenbeg barbenbge barbengbe barbengeb barbeenbg barbeengb
barbeebng barbeebgn barbeegbn barbeegnb barbebeng barbebegn barbebneg barbebnge barbebgne barbebgen barbegebn
barbegenb barbegben barbegbne barbegnbe barbegneb barbeenbg barbeengb barbeebng barbeebgn barbeegbn barbeegnb
barbenebg barbenegb barbenbeg barbenbge barbengbe barbengeb barbebneg barbebnge barbebeng barbebegn barbebgen
barbebgne barbegnbe barbegneb barbegbne barbegben barbegebn barbegenb barbbeeng barbbeegn barbbeneg barbbenge
barbbegne barbbegen barbbeeng barbbeegn barbbeneg barbbenge barbbegne barbbegen barbbneeg barbbnege barbbneeg
barbbnege barbbngee barbbngee barbbgene barbbgeen barbbgnee barbbgnee barbbgene barbbgeen barbgeebn barbgeenb
barbgeben barbgebne barbgenbe barbgeneb barbgeebn barbgeenb barbgeben barbgebne barbgenbe barbgeneb barbgbeen
barbgbene barbgbeen barbgbene barbgbnee barbgbnee barbgnebe barbgneeb barbgnbee barbgnbee barbgnebe barbgneeb
barenbebg barenbegb barenbbeg barenbbge barenbgbe barenbgeb barenebbg barenebgb barenebbg barenebgb barenegbb
barenegbb barenbebg barenbegb barenbbeg barenbbge barenbgbe barenbgeb barengebb barengebb barengbeb barengbbe
barengbbe barengbeb barebnebg barebnegb barebnbeg barebnbge barebngbe barebngeb barebenbg barebengb barebebng
barebebgn barebegbn barebegnb barebbeng barebbegn barebbneg barebbnge barebbgne barebbgen barebgebn barebgenb
barebgben barebgbne barebgnbe barebgneb bareebnbg bareebngb bareebbng bareebbgn bareebgbn bareebgnb bareenbbg
bareenbgb bareenbbg bareenbgb bareengbb bareengbb bareebnbg bareebngb bareebbng bareebbgn bareebgbn bareebgnb
bareegnbb bareegnbb bareegbnb bareegbbn bareegbbn bareegbnb barebbeng barebbegn barebbneg barebbnge barebbgne
barebbgen barebebng barebebgn barebenbg barebengb barebegnb barebegbn barebnebg barebnegb barebnbeg barebnbge
barebngbe barebngeb barebgenb barebgebn barebgneb barebgnbe barebgbne barebgben baregbebn baregbenb baregbben
baregbbne baregbnbe baregbneb baregebbn baregebnb baregebbn baregebnb baregenbb baregenbb baregbebn baregbenb
baregbben baregbbne baregbnbe baregbneb baregnebb baregnebb baregnbeb baregnbbe baregnbbe baregnbeb barbnbeeg
barbnbege barbnbeeg barbnbege barbnbgee barbnbgee barbnebeg barbnebge barbneebg barbneegb barbnegeb barbnegbe
barbneebg barbneegb barbnebeg barbnebge barbnegbe barbnegeb barbngeeb barbngebe barbngeeb barbngebe barbngbee
barbngbee barbbneeg barbbnege barbbneeg barbbnege barbbngee barbbngee barbbeneg barbbenge barbbeeng barbbeegn
barbbegen barbbegne barbbeeng barbbeegn barbbeneg barbbenge barbbegne barbbegen barbbgeen barbbgene barbbgeen
barbbgene barbbgnee barbbgnee barbebneg barbebnge barbebeng barbebegn barbebgen barbebgne barbenbeg barbenbge
barbenebg barbenegb barbengeb barbengbe barbeenbg barbeengb barbeebng barbeebgn barbeegbn barbeegnb barbegneb
barbegnbe barbegenb barbegebn barbegben barbegbne barbebeng barbebegn barbebneg barbebnge barbebgne barbebgen
barbeebng barbeebgn barbeenbg barbeengb barbeegnb barbeegbn barbenebg barbenegb barbenbeg barbenbge barbengbe
barbengeb barbegenb barbegebn barbegneb barbegnbe barbegbne barbegben barbgbeen barbgbene barbgbeen barbgbene
barbgbnee barbgbnee barbgeben barbgebne barbgeebn barbgeenb barbgeneb barbgenbe barbgeebn barbgeenb barbgeben
barbgebne barbgenbe barbgeneb barbgneeb barbgnebe barbgneeb barbgnebe barbgnbee barbgnbee bargnbebe bargnbeeb
bargnbbee bargnbbee bargnbebe bargnbeeb bargnebbe bargnebeb bargnebbe bargnebeb bargneebb bargneebb bargnbebe
bargnbeeb bargnbbee bargnbbee bargnbebe bargnbeeb bargneebb bargneebb bargnebeb bargnebbe bargnebbe bargnebeb
bargbnebe bargbneeb bargbnbee bargbnbee bargbnebe bargbneeb bargbenbe bargbeneb bargbebne bargbeben bargbeebn
bargbeenb bargbbene bargbbeen bargbbnee bargbbnee bargbbene bargbbeen bargbeebn bargbeenb bargbeben bargbebne
bargbenbe bargbeneb bargebnbe bargebneb bargebbne bargebben bargebebn bargebenb bargenbbe bargenbeb bargenbbe
bargenbeb bargenebb bargenebb bargebnbe bargebneb bargebbne bargebben bargebebn bargebenb bargeenbb bargeenbb
bargeebnb bargeebbn bargeebbn bargeebnb bargbbene bargbbeen bargbbnee bargbbnee bargbbene bargbbeen bargbebne
bargbeben bargbenbe bargbeneb bargbeenb bargbeebn bargbnebe bargbneeb bargbnbee bargbnbee bargbnebe bargbneeb
bargbeenb bargbeebn bargbeneb bargbenbe bargbebne bargbeben bargebebn bargebenb bargebben bargebbne bargebnbe
bargebneb bargeebbn bargeebnb bargeebbn bargeebnb bargeenbb bargeenbb bargebebn bargebenb bargebben bargebbne
bargebnbe bargebneb bargenebb bargenebb bargenbeb bargenbbe bargenbbe bargenbeb bagenberb bagenbebr bagenbreb
bagenbrbe bagenbbre bagenbber bagenebrb bagenebbr bagenerbb bagenerbb bagenebrb bagenebbr bagenrebb bagenrebb
bagenrbeb bagenrbbe bagenrbbe bagenrbeb bagenberb bagenbebr bagenbreb bagenbrbe bagenbbre bagenbber bagebnerb
bagebnebr bagebnreb bagebnrbe bagebnbre bagebnber bagebenrb bagebenbr bagebernb bageberbn bagebebrn bagebebnr
bagebrenb bagebrebn bagebrneb bagebrnbe bagebrbne bagebrben bagebbern bagebbenr bagebbren bagebbrne bagebbnre
bagebbner bageebnrb bageebnbr bageebrnb bageebrbn bageebbrn bageebbnr bageenbrb bageenbbr bageenrbb bageenrbb
bageenbrb bageenbbr bageernbb bageernbb bageerbnb bageerbbn bageerbbn bageerbnb bageebnrb bageebnbr bageebrnb
bageebrbn bageebbrn bageebbnr bagerbenb bagerbebn bagerbneb bagerbnbe bagerbbne bagerbben bagerebnb bagerebbn
bagerenbb bagerenbb bagerebnb bagerebbn bagernebb bagernebb bagernbeb bagernbbe bagernbbe bagernbeb bagerbenb
bagerbebn bagerbneb bagerbnbe bagerbbne bagerbben bagebbern bagebbenr bagebbren bagebbrne bagebbnre bagebbner
bagebebrn bagebebnr bageberbn bagebernb bagebenrb bagebenbr bagebrebn bagebrenb bagebrben bagebrbne bagebrnbe
bagebrneb bagebnerb bagebnebr bagebnreb bagebnrbe bagebnbre bagebnber bagneberb bagnebebr bagnebreb bagnebrbe
bagnebbre bagnebber bagneebrb bagneebbr bagneerbb bagneerbb bagneebrb bagneebbr bagnerebb bagnerebb bagnerbeb
bagnerbbe bagnerbbe bagnerbeb bagneberb bagnebebr bagnebreb bagnebrbe bagnebbre bagnebber bagnbeerb bagnbeebr
bagnbereb bagnberbe bagnbebre bagnbeber bagnbeerb bagnbeebr bagnbereb bagnberbe bagnbebre bagnbeber bagnbreeb
bagnbrebe bagnbreeb bagnbrebe bagnbrbee bagnbrbee bagnbbere bagnbbeer bagnbbree bagnbbree bagnbbere bagnbbeer
bagneberb bagnebebr bagnebreb bagnebrbe bagnebbre bagnebber bagneebrb bagneebbr bagneerbb bagneerbb bagneebrb
bagneebbr bagnerebb bagnerebb bagnerbeb bagnerbbe bagnerbbe bagnerbeb bagneberb bagnebebr bagnebreb bagnebrbe
bagnebbre bagnebber bagnrbeeb bagnrbebe bagnrbeeb bagnrbebe bagnrbbee bagnrbbee bagnrebeb bagnrebbe bagnreebb
bagnreebb bagnrebeb bagnrebbe bagnreebb bagnreebb bagnrebeb bagnrebbe bagnrebbe bagnrebeb bagnrbeeb bagnrbebe
bagnrbeeb bagnrbebe bagnrbbee bagnrbbee bagnbbere bagnbbeer bagnbbree bagnbbree bagnbbere bagnbbeer bagnbebre
bagnbeber bagnberbe bagnbereb bagnbeerb bagnbeebr bagnbrebe bagnbreeb bagnbrbee bagnbrbee bagnbrebe bagnbreeb
bagnbeerb bagnbeebr bagnbereb bagnberbe bagnbebre bagnbeber bagbneerb bagbneebr bagbnereb bagbnerbe bagbnebre
bagbneber bagbneerb bagbneebr bagbnereb bagbnerbe bagbnebre bagbneber bagbnreeb bagbnrebe bagbnreeb bagbnrebe
bagbnrbee bagbnrbee bagbnbere bagbnbeer bagbnbree bagbnbree bagbnbere bagbnbeer bagbenerb bagbenebr bagbenreb
bagbenrbe bagbenbre bagbenber bagbeenrb bagbeenbr bagbeernb bagbeerbn bagbeebrn bagbeebnr bagberenb bagberebn
bagberneb bagbernbe bagberbne bagberben bagbebern bagbebenr bagbebren bagbebrne bagbebnre bagbebner bagbeenrb
bagbeenbr bagbeernb bagbeerbn bagbeebrn bagbeebnr bagbenerb bagbenebr bagbenreb bagbenrbe bagbenbre bagbenber
bagberneb bagbernbe bagberenb bagberebn bagberben bagberbne bagbebnre bagbebner bagbebrne bagbebren bagbebern
bagbebenr bagbreenb bagbreebn bagbreneb bagbrenbe bagbrebne bagbreben bagbreenb bagbreebn bagbreneb bagbrenbe
bagbrebne bagbreben bagbrneeb bagbrnebe bagbrneeb bagbrnebe bagbrnbee bagbrnbee bagbrbene bagbrbeen bagbrbnee
bagbrbnee bagbrbene bagbrbeen bagbbeern bagbbeenr bagbberen bagbberne bagbbenre bagbbener bagbbeern bagbbeenr
bagbberen bagbberne bagbbenre bagbbener bagbbreen bagbbrene bagbbreen bagbbrene bagbbrnee bagbbrnee bagbbnere
bagbbneer bagbbnree bagbbnree bagbbnere bagbbneer bagenberb bagenbebr bagenbreb bagenbrbe bagenbbre bagenbber
bagenebrb bagenebbr bagenerbb bagenerbb bagenebrb bagenebbr bagenrebb bagenrebb bagenrbeb bagenrbbe bagenrbbe
bagenrbeb bagenberb bagenbebr bagenbreb bagenbrbe bagenbbre bagenbber bagebnerb bagebnebr bagebnreb bagebnrbe
bagebnbre bagebnber bagebenrb bagebenbr bagebernb bageberbn bagebebrn bagebebnr bagebrenb bagebrebn bagebrneb
bagebrnbe bagebrbne bagebrben bagebbern bagebbenr bagebbren bagebbrne bagebbnre bagebbner bageebnrb bageebnbr
bageebrnb bageebrbn bageebbrn bageebbnr bageenbrb bageenbbr bageenrbb bageenrbb bageenbrb bageenbbr bageernbb
bageernbb bageerbnb bageerbbn bageerbbn bageerbnb bageebnrb bageebnbr bageebrnb bageebrbn bageebbrn bageebbnr
bagerbenb bagerbebn bagerbneb bagerbnbe bagerbbne bagerbben bagerebnb bagerebbn bagerenbb bagerenbb bagerebnb
bagerebbn bagernebb bagernebb bagernbeb bagernbbe bagernbbe bagernbeb bagerbenb bagerbebn bagerbneb bagerbnbe
bagerbbne bagerbben bagebbern bagebbenr bagebbren bagebbrne bagebbnre bagebbner bagebebrn bagebebnr bageberbn
bagebernb bagebenrb bagebenbr bagebrebn bagebrenb bagebrben bagebrbne bagebrnbe bagebrneb bagebnerb bagebnebr
bagebnreb bagebnrbe bagebnbre bagebnber bagrnbeeb bagrnbebe bagrnbeeb bagrnbebe bagrnbbee bagrnbbee bagrnebeb
bagrnebbe bagrneebb bagrneebb bagrnebeb bagrnebbe bagrneebb bagrneebb bagrnebeb bagrnebbe bagrnebbe bagrnebeb
bagrnbeeb bagrnbebe bagrnbeeb bagrnbebe bagrnbbee bagrnbbee bagrbneeb bagrbnebe bagrbneeb bagrbnebe bagrbnbee
bagrbnbee bagrbeneb bagrbenbe bagrbeenb bagrbeebn bagrbeben bagrbebne bagrbeenb bagrbeebn bagrbeneb bagrbenbe
bagrbebne bagrbeben bagrbbeen bagrbbene bagrbbeen bagrbbene bagrbbnee bagrbbnee bagrebneb bagrebnbe bagrebenb
bagrebebn bagrebben bagrebbne bagrenbeb bagrenbbe bagrenebb bagrenebb bagrenbeb bagrenbbe bagreenbb bagreenbb
bagreebnb bagreebbn bagreebbn bagreebnb bagrebneb bagrebnbe bagrebenb bagrebebn bagrebben bagrebbne bagrebenb
bagrebebn bagrebneb bagrebnbe bagrebbne bagrebben bagreebnb bagreebbn bagreenbb bagreenbb bagreebnb bagreebbn
bagrenebb bagrenebb bagrenbeb bagrenbbe bagrenbbe bagrenbeb bagrebenb bagrebebn bagrebneb bagrebnbe bagrebbne
bagrebben bagrbbeen bagrbbene bagrbbeen bagrbbene bagrbbnee bagrbbnee bagrbeben bagrbebne bagrbeebn bagrbeenb
bagrbeneb bagrbenbe bagrbeebn bagrbeenb bagrbeben bagrbebne bagrbenbe bagrbeneb bagrbneeb bagrbnebe bagrbneeb
bagrbnebe bagrbnbee bagrbnbee bagbnbere bagbnbeer bagbnbree bagbnbree bagbnbere bagbnbeer bagbnebre bagbneber
bagbnerbe bagbnereb bagbneerb bagbneebr bagbnrebe bagbnreeb bagbnrbee bagbnrbee bagbnrebe bagbnreeb bagbneerb
bagbneebr bagbnereb bagbnerbe bagbnebre bagbneber bagbbnere bagbbneer bagbbnree bagbbnree bagbbnere bagbbneer
bagbbenre bagbbener bagbberne bagbberen bagbbeern bagbbeenr bagbbrene bagbbreen bagbbrnee bagbbrnee bagbbrene
bagbbreen bagbbeern bagbbeenr bagbberen bagbberne bagbbenre bagbbener bagbebnre bagbebner bagbebrne bagbebren
bagbebern bagbebenr bagbenbre bagbenber bagbenrbe bagbenreb bagbenerb bagbenebr bagbernbe bagberneb bagberbne
bagberben bagberebn bagberenb bagbeenrb bagbeenbr bagbeernb bagbeerbn bagbeebrn bagbeebnr bagbrbene bagbrbeen
bagbrbnee bagbrbnee bagbrbene bagbrbeen bagbrebne bagbreben bagbrenbe bagbreneb bagbreenb bagbreebn bagbrnebe
bagbrneeb bagbrnbee bagbrnbee bagbrnebe bagbrneeb bagbreenb bagbreebn bagbreneb bagbrenbe bagbrebne bagbreben
bagbebern bagbebenr bagbebren bagbebrne bagbebnre bagbebner bagbeebrn bagbeebnr bagbeerbn bagbeernb bagbeenrb
bagbeenbr bagberebn bagberenb bagberben bagberbne bagbernbe bagberneb bagbenerb bagbenebr bagbenreb bagbenrbe
bagbenbre bagbenber

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us