easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

praemiaque

superaffiliation

copiosissimoque

bertucci

benyamini

goldbricking

perferentque

sychnocarpous

buckplate

scoparia

ardentness

karnscity

tramcars

unimpedness

saeculisque

biarent

perfugerant

appellavissesque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: axxess
cipher variations:
byyftt czzguu daahvv ebbiww fccjxx
gddkyy heelzz iffmaa jggnbb khhocc
liipdd mjjqee nkkrff ollsgg pmmthh
qnnuii roovjj sppwkk tqqxll urrymm
vssznn wttaoo xuubpp yvvcqq zwwdrr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: axxess
Cipher: zccvhh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: axxess
Cipher: AAAAA BABAB BABAB AABAA BAAAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: axxess
cipher variations:
byyfttbssnddbmmvnnbggdxxbaalhhbuutrrbiijllbccrvv
bwwzffbqqhppbkkpzzbeexjjczzguucttoeecnnwoochheyy
cbbmiicvvusscjjkmmcddswwcxxaggcrriqqcllqaacffykk
daahvvduupffdooxppdiifzzdccnjjdwwvttdkklnndeetxx
dyybhhdssjrrdmmrbbdggzllebbiwwevvqggeppyqqejjgaa
eddokkexxwuuellmooeffuyyezzciiettkssennsccehhamm
fccjxxfwwrhhfqqzrrfkkhbbfeepllfyyxvvfmmnppfggvzz
faadjjfuulttfootddfiibnngddkyygxxsiigrrassgllicc
gffqmmgzzywwgnnoqqghhwaagbbekkgvvmuugppueegjjcoo
heelzzhyytjjhssbtthmmjddhggrnnhaazxxhooprrhiixbb
hccfllhwwnvvhqqvffhkkdppiffmaaizzukkittcuuinnkee
ihhsooibbayyippqssijjycciddgmmixxowwirrwggilleqq
jggnbbjaavlljuudvvjoolffjiitppjccbzzjqqrttjkkzdd
jeehnnjyypxxjssxhhjmmfrrkhhocckbbwmmkvvewwkppmgg
kjjuqqkddcaakrrsuukllaeekffiookzzqyykttyiiknngss
liipddlccxnnlwwfxxlqqnhhlkkvrrleedbblsstvvlmmbff
lggjpplaarzzluuzjjloohttmjjqeemddyoomxxgyymrroii
mllwssmffeccmttuwwmnncggmhhkqqmbbsaamvvakkmppiuu
nkkrffneezppnyyhzznsspjjnmmxttnggfddnuuvxxnoodhh
niilrrncctbbnwwbllnqqjvvollsggoffaqqozziaaottqkk
onnyuuohhgeeovvwyyoppeiiojjmssodduccoxxcmmorrkww
pmmthhpggbrrpaajbbpuurllpoozvvpiihffpwwxzzpqqfjj
pkknttpeevddpyydnnpsslxxqnnuiiqhhcssqbbkccqvvsmm
qppawwqjjiggqxxyaaqrrgkkqllouuqffweeqzzeooqttmyy
roovjjriidttrcclddrwwtnnrqqbxxrkkjhhryyzbbrsshll
rmmpvvrggxffraafppruunzzsppwkksjjeuusddmeesxxuoo
srrcyysllkiiszzaccsttimmsnnqwwshhyggsbbgqqsvvoaa
tqqxlltkkfvvteenfftyyvpptssdzztmmljjtaabddtuujnn
toorxxtiizhhtcchrrtwwpbburrymmullgwwuffogguzzwqq
utteaaunnmkkubbceeuvvkoouppsyyujjaiiuddissuxxqcc
vssznnvmmhxxvggphhvaaxrrvuufbbvoonllvccdffvwwlpp
vqqtzzvkkbjjveejttvyyrddwttaoownniyywhhqiiwbbyss
wvvgccwppommwddeggwxxmqqwrruaawllckkwffkuuwzzsee
xuubppxoojzzxiirjjxcczttxwwhddxqqpnnxeefhhxyynrr
xssvbbxmmdllxgglvvxaatffyvvcqqyppkaayjjskkyddauu
yxxieeyrrqooyffgiiyzzossyttwccynnemmyhhmwwybbugg
zwwdrrzqqlbbzkktllzeebvvzyyjffzssrppzgghjjzaaptt
zuuxddzoofnnziinxxzccvhhaxxessarrmccallummaffcww
azzkggattsqqahhikkabbquuavvyeeappgooajjoyyaddwii

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: axxess
Cipher: nkkrff

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: axxess
Cipher: 113535513434

Extended Methods:
Method #1

Plaintext: axxess
method variations:
fcckxxlhhpccqnnuhhvssznn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a x x e s s 
1 3 3 5 3 3 
1 5 5 1 4 4 
They are then read out in rows:
133533155144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: axxess
Cipher: lxnvet

Read more ...
Method #3

Plaintext: axxess
method variations:
lpzlod pzlodl zlodlp
lodlpz odlpzl dlpzlo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: axxess

all 720 cipher variations:
axxess axxess axxses axxsse axxsse axxses axexss axexss axesxs axessx axessx
axesxs axsexs axsesx axsxes axsxse axssxe axssex axsesx axsexs axssex axssxe
axsxse axsxes axxess axxess axxses axxsse axxsse axxses axexss axexss axesxs
axessx axessx axesxs axsexs axsesx axsxes axsxse axssxe axssex axsesx axsexs
axssex axssxe axsxse axsxes aexxss aexxss aexsxs aexssx aexssx aexsxs aexxss
aexxss aexsxs aexssx aexssx aexsxs aesxxs aesxsx aesxxs aesxsx aessxx aessxx
aesxsx aesxxs aessxx aessxx aesxsx aesxxs asxexs asxesx asxxes asxxse asxsxe
asxsex asexxs asexsx asexxs asexsx asesxx asesxx asxexs asxesx asxxes asxxse
asxsxe asxsex assexx assexx assxex assxxe assxxe assxex asxesx asxexs asxsex
asxsxe asxxse asxxes asexsx asexxs asesxx asesxx asexsx asexxs assexx assexx
assxex assxxe assxxe assxex asxesx asxexs asxsex asxsxe asxxse asxxes xaxess
xaxess xaxses xaxsse xaxsse xaxses xaexss xaexss xaesxs xaessx xaessx xaesxs
xasexs xasesx xasxes xasxse xassxe xassex xasesx xasexs xassex xassxe xasxse
xasxes xxaess xxaess xxases xxasse xxasse xxases xxeass xxeass xxesas xxessa
xxessa xxesas xxseas xxsesa xxsaes xxsase xxssae xxssea xxsesa xxseas xxssea
xxssae xxsase xxsaes xexass xexass xexsas xexssa xexssa xexsas xeaxss xeaxss
xeasxs xeassx xeassx xeasxs xesaxs xesasx xesxas xesxsa xessxa xessax xesasx
xesaxs xessax xessxa xesxsa xesxas xsxeas xsxesa xsxaes xsxase xsxsae xsxsea
xsexas xsexsa xseaxs xseasx xsesax xsesxa xsaexs xsaesx xsaxes xsaxse xsasxe
xsasex xsseax xssexa xssaex xssaxe xssxae xssxea xsxesa xsxeas xsxsea xsxsae
xsxase xsxaes xsexsa xsexas xsesxa xsesax xseasx xseaxs xssexa xsseax xssxea
xssxae xssaxe xssaex xsaesx xsaexs xsasex xsasxe xsaxse xsaxes xxaess xxaess
xxases xxasse xxasse xxases xxeass xxeass xxesas xxessa xxessa xxesas xxseas
xxsesa xxsaes xxsase xxssae xxssea xxsesa xxseas xxssea xxssae xxsase xxsaes
xaxess xaxess xaxses xaxsse xaxsse xaxses xaexss xaexss xaesxs xaessx xaessx
xaesxs xasexs xasesx xasxes xasxse xassxe xassex xasesx xasexs xassex xassxe
xasxse xasxes xeaxss xeaxss xeasxs xeassx xeassx xeasxs xexass xexass xexsas
xexssa xexssa xexsas xesxas xesxsa xesaxs xesasx xessax xessxa xesxsa xesxas
xessxa xessax xesasx xesaxs xsaexs xsaesx xsaxes xsaxse xsasxe xsasex xseaxs
xseasx xsexas xsexsa xsesxa xsesax xsxeas xsxesa xsxaes xsxase xsxsae xsxsea
xssexa xsseax xssxea xssxae xssaxe xssaex xsaesx xsaexs xsasex xsasxe xsaxse
xsaxes xseasx xseaxs xsesax xsesxa xsexsa xsexas xsseax xssexa xssaex xssaxe
xssxae xssxea xsxesa xsxeas xsxsea xsxsae xsxase xsxaes exxass exxass exxsas
exxssa exxssa exxsas exaxss exaxss exasxs exassx exassx exasxs exsaxs exsasx
exsxas exsxsa exssxa exssax exsasx exsaxs exssax exssxa exsxsa exsxas exxass
exxass exxsas exxssa exxssa exxsas exaxss exaxss exasxs exassx exassx exasxs
exsaxs exsasx exsxas exsxsa exssxa exssax exsasx exsaxs exssax exssxa exsxsa
exsxas eaxxss eaxxss eaxsxs eaxssx eaxssx eaxsxs eaxxss eaxxss eaxsxs eaxssx
eaxssx eaxsxs easxxs easxsx easxxs easxsx eassxx eassxx easxsx easxxs eassxx
eassxx easxsx easxxs esxaxs esxasx esxxas esxxsa esxsxa esxsax esaxxs esaxsx
esaxxs esaxsx esasxx esasxx esxaxs esxasx esxxas esxxsa esxsxa esxsax essaxx
essaxx essxax essxxa essxxa essxax esxasx esxaxs esxsax esxsxa esxxsa esxxas
esaxsx esaxxs esasxx esasxx esaxsx esaxxs essaxx essaxx essxax essxxa essxxa
essxax esxasx esxaxs esxsax esxsxa esxxsa esxxas sxxeas sxxesa sxxaes sxxase
sxxsae sxxsea sxexas sxexsa sxeaxs sxeasx sxesax sxesxa sxaexs sxaesx sxaxes
sxaxse sxasxe sxasex sxseax sxsexa sxsaex sxsaxe sxsxae sxsxea sxxeas sxxesa
sxxaes sxxase sxxsae sxxsea sxexas sxexsa sxeaxs sxeasx sxesax sxesxa sxaexs
sxaesx sxaxes sxaxse sxasxe sxasex sxseax sxsexa sxsaex sxsaxe sxsxae sxsxea
sexxas sexxsa sexaxs sexasx sexsax sexsxa sexxas sexxsa sexaxs sexasx sexsax
sexsxa seaxxs seaxsx seaxxs seaxsx seasxx seasxx sesxax sesxxa sesaxx sesaxx
sesxax sesxxa saxexs saxesx saxxes saxxse saxsxe saxsex saexxs saexsx saexxs
saexsx saesxx saesxx saxexs saxesx saxxes saxxse saxsxe saxsex sasexx sasexx
sasxex sasxxe sasxxe sasxex ssxeax ssxexa ssxaex ssxaxe ssxxae ssxxea ssexax
ssexxa sseaxx sseaxx ssexax ssexxa ssaexx ssaexx ssaxex ssaxxe ssaxxe ssaxex
ssxeax ssxexa ssxaex ssxaxe ssxxae ssxxea sxxesa sxxeas sxxsea sxxsae sxxase
sxxaes sxexsa sxexas sxesxa sxesax sxeasx sxeaxs sxsexa sxseax sxsxea sxsxae
sxsaxe sxsaex sxaesx sxaexs sxasex sxasxe sxaxse sxaxes sxxesa sxxeas sxxsea
sxxsae sxxase sxxaes sxexsa sxexas sxesxa sxesax sxeasx sxeaxs sxsexa sxseax
sxsxea sxsxae sxsaxe sxsaex sxaesx sxaexs sxasex sxasxe sxaxse sxaxes sexxsa
sexxas sexsxa sexsax sexasx sexaxs sexxsa sexxas sexsxa sexsax sexasx sexaxs
sesxxa sesxax sesxxa sesxax sesaxx sesaxx seaxsx seaxxs seasxx seasxx seaxsx
seaxxs ssxexa ssxeax ssxxea ssxxae ssxaxe ssxaex ssexxa ssexax ssexxa ssexax
sseaxx sseaxx ssxexa ssxeax ssxxea ssxxae ssxaxe ssxaex ssaexx ssaexx ssaxex
ssaxxe ssaxxe ssaxex saxesx saxexs saxsex saxsxe saxxse saxxes saexsx saexxs
saesxx saesxx saexsx saexxs sasexx sasexx sasxex sasxxe sasxxe sasxex saxesx
saxexs saxsex saxsxe saxxse saxxes

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us