easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

brookless

votisque

gugel

unfermentably

heiler

vidya

chinnici

cortright

outoffice

outgrowth

alkalinization

naprapathy

flumine

nouem

wythe

fleshgolem

leucitoid

ponch


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: attulitque
cipher variations:
buuvmjurvf cvvwnkvswg dwwxolwtxh exxypmxuyi fyyzqnyvzj
gzzarozwak haabspaxbl ibbctqbycm jccdurczdn kddevsdaeo
leefwtebfp mffgxufcgq ngghyvgdhr ohhizwheis piijaxifjt
qjjkbyjgku rkklczkhlv sllmdalimw tmmnebmjnx unnofcnkoy
voopgdolpz wppqhepmqa xqqrifqnrb yrrsjgrosc zsstkhsptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: attulitque
Cipher: zggforgjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: attulitque
Cipher: AAAAA BAABA BAABA BAABB ABABA ABAAA BAABA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: attulitque
cipher variations:
buuvmjurvfbggjizgxjnbssxepsdxvbeelafejldbqqzwvqpzlbccnslcvntbaapkrahpjbmmdghmndr
byyrcxytrzbkkfynkzfhbwwtudwftpbiihqtilhxcvvwnkvswgchhkjahykocttyfqteywcffmbgfkme
crraxwrqamcddotmdwoucbbqlsbiqkcnnehinoesczzsdyzusacllgzolagicxxuvexguqcjjirujmiy
dwwxolwtxhdiilkbizlpduuzgrufzxdggnchglnfdssbyxsrbndeepunexpvdccrmtcjrldoofijopft
daatezavtbdmmhapmbhjdyyvwfyhvrdkkjsvknjzexxypmxuyiejjmlcjamqevvahsvgayehhodihmog
ettczytscoeffqvofyqweddsnudksmeppgjkpqguebbufabwucennibqncikezzwxgziwsellktwloka
fyyzqnyvzjfkknmdkbnrfwwbitwhbzfiipejinphfuudazutdpfggrwpgzrxfeetoveltnfqqhklqrhv
fccvgbcxvdfoojcrodjlfaaxyhajxtfmmluxmplbgzzarozwakgllonelcosgxxcjuxicagjjqfkjoqi
gvvebavueqghhsxqhasygffupwfmuogrrilmrsiwgddwhcdywegppkdspekmgbbyzibkyugnnmvynqmc
haabspaxblhmmpofmdpthyydkvyjdbhkkrglkprjhwwfcbwvfrhiityribtzhggvqxgnvphssjmnstjx
heexidezxfhqqletqflnhcczajclzvhoonwzorndibbctqbycminnqpgnequizzelwzkecillshmlqsk
ixxgdcxwgsijjuzsjcuaihhwryhowqittknotukyiffyjefaygirrmfurgmoiddabkdmawippoxapsoe
jccdurczdnjoorqhofrvjaafmxalfdjmmtinmrtljyyhedyxhtjkkvatkdvbjiixszipxrjuulopuvlz
jggzkfgbzhjssngvshnpjeebclenbxjqqpybqtpfkddevsdaeokppsripgswkbbgnybmgeknnujonsum
kzzifezyiukllwbulewckjjytajqyskvvmpqvwmakhhalghcaikttohwtioqkffcdmfocykrrqzcruqg
leefwtebfplqqtsjqhtxlcchozcnhfloovkpotvnlaajgfazjvlmmxcvmfxdlkkzubkrztlwwnqrwxnb
liibmhidbjluupixujprlggdengpdzlssradsvrhmffgxufcgqmrrutkriuymddipadoigmppwlqpuwo
mbbkhgbakwmnnydwngyemllavclsaumxxorsxyocmjjcnijeckmvvqjyvkqsmhhefohqeamttsbetwsi
ngghyvgdhrnssvulsjvzneejqbepjhnqqxmrqvxpncclihcblxnoozexohzfnmmbwdmtbvnyypstyzpd
nkkdojkfdlnwwrkzwlrtniifgpirfbnuutcfuxtjohhizwheisottwvmtkwaoffkrcfqkiorrynsrwyq
oddmjidcmyoppafypiagonncxenucwozzqtuzaqeollepklgemoxxslaxmsuojjghqjsgcovvudgvyuk
piijaxifjtpuuxwnulxbpgglsdgrljpsszotsxzrpeenkjednzpqqbgzqjbhpoodyfovdxpaaruvabrf
pmmfqlmhfnpyytmbyntvpkkhirkthdpwwvehwzvlqjjkbyjgkuqvvyxovmycqhhmtehsmkqttaputyas
qffolkfeoaqrrcharkciqppezgpweyqbbsvwbcsgqnngrmnigoqzzunczouwqllijsluieqxxwfixawm
rkklczkhlvrwwzypwnzdriinufitnlruubqvuzbtrggpmlgfpbrssdibsldjrqqfahqxfzrcctwxcdth
roohsnojhpraavodapvxrmmjktmvjfryyxgjybxnsllmdalimwsxxazqxoaesjjovgjuomsvvcrwvacu
shhqnmhgqcsttejctmeksrrgbirygasdduxydeuisppitopkiqsbbwpebqwysnnklunwkgszzyhkzcyo
tmmnebmjnxtyybarypbftkkpwhkvpntwwdsxwbdvtiironihrdtuufkdunfltsshcjszhbteevyzefvj
tqqjupqljrtccxqfcrxztoolmvoxlhtaaziladzpunnofcnkoyuzzcbszqcgullqxilwqouxxetyxcew
ujjspojiseuvvglevogmuttidktaicuffwzafgwkurrkvqrmksuddyrgdsyauppmnwpymiubbajmbeaq
voopgdolpzvaadctardhvmmryjmxrpvyyfuzydfxvkktqpkjtfvwwhmfwphnvuujelubjdvggxabghxl
vsslwrsnltveezshetzbvqqnoxqznjvccbkncfbrwppqhepmqawbbedubseiwnnszknysqwzzgvazegy
wllurqlkugwxxingxqiowvvkfmvckewhhybchiymwttmxstomuwffatifuacwrropyraokwddclodgcs
xqqrifqnrbxccfevctfjxootaloztrxaahwbafhzxmmvsrmlvhxyyjohyrjpxwwlgnwdlfxiizcdijzn
xuunytupnvxggbujgvbdxsspqzsbplxeedmpehdtyrrsjgroscyddgfwdugkyppubmpausybbixcbgia
ynnwtsnmwiyzzkpizskqyxxmhoxemgyjjadejkaoyvvozuvqowyhhcvkhwceyttqratcqmyffenqfieu
zsstkhsptdzeehgxevhlzqqvcnqbvtzccjydchjbzooxutonxjzaalqjatlrzyynipyfnhzkkbefklbp
zwwpavwrpxziidwlixdfzuursbudrnzggforgjfvattulitqueaffihyfwimarrwdorcwuaddkzedikc
appyvupoykabbmrkbumsazzojqzgoiallcfglmcqaxxqbwxsqyajjexmjyegavvstcvesoahhgpshkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: attulitque
Cipher: ngghyvgdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: attulitque
Cipher: 11444454134244145451

Extended Methods:
Method #1

Plaintext: attulitque
method variations:
fyyzqoyvzklddevtdaepqiikayifkuvoopfdolpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a t t u l i t q u e 
1 4 4 5 1 4 4 1 5 5 
1 4 4 4 3 2 4 4 4 1 
They are then read out in rows:
14451441551444324441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: attulitque
Cipher: qyqdzqthtd

Read more ...
Method #3

Plaintext: attulitque
method variations:
qtydsrdyya tydsrdyyaq ydsrdyyaqt
dsrdyyaqty srdyyaqtyd rdyyaqtyds
dyyaqtydsr yyaqtydsrd yaqtydsrdy
aqtydsrdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: attulitque

first 5040 cipher variations(3628800 total)
attulitque attulitqeu attulituqe attulitueq attuliteuq attulitequ attuliqtue attuliqteu attuliqute attuliquet attuliqeut
attuliqetu attuliuqte attuliuqet attuliutqe attuliuteq attuliuetq attuliueqt attuliequt attulieqtu attulieuqt attulieutq
attulietuq attulietqu attultique attultiqeu attultiuqe attultiueq attultieuq attultiequ attultqiue attultqieu attultquie
attultquei attultqeui attultqeiu attultuqie attultuqei attultuiqe attultuieq attultueiq attultueqi attultequi attulteqiu
attulteuqi attulteuiq attulteiuq attulteiqu attulqtiue attulqtieu attulqtuie attulqtuei attulqteui attulqteiu attulqitue
attulqiteu attulqiute attulqiuet attulqieut attulqietu attulquite attulquiet attulqutie attulqutei attulqueti attulqueit
attulqeiut attulqeitu attulqeuit attulqeuti attulqetui attulqetiu attulutqie attulutqei attulutiqe attulutieq attuluteiq
attuluteqi attuluqtie attuluqtei attuluqite attuluqiet attuluqeit attuluqeti attuluiqte attuluiqet attuluitqe attuluiteq
attuluietq attuluieqt attulueqit attulueqti attulueiqt attulueitq attuluetiq attuluetqi attuletqui attuletqiu attuletuqi
attuletuiq attuletiuq attuletiqu attuleqtui attuleqtiu attulequti attulequit attuleqiut attuleqitu attuleuqti attuleuqit
attuleutqi attuleutiq attuleuitq attuleuiqt attuleiqut attuleiqtu attuleiuqt attuleiutq attuleituq attuleitqu attuiltque
attuiltqeu attuiltuqe attuiltueq attuilteuq attuiltequ attuilqtue attuilqteu attuilqute attuilquet attuilqeut attuilqetu
attuiluqte attuiluqet attuilutqe attuiluteq attuiluetq attuilueqt attuilequt attuileqtu attuileuqt attuileutq attuiletuq
attuiletqu attuitlque attuitlqeu attuitluqe attuitlueq attuitleuq attuitlequ attuitqlue attuitqleu attuitqule attuitquel
attuitqeul attuitqelu attuituqle attuituqel attuitulqe attuituleq attuituelq attuitueql attuitequl attuiteqlu attuiteuql
attuiteulq attuiteluq attuitelqu attuiqtlue attuiqtleu attuiqtule attuiqtuel attuiqteul attuiqtelu attuiqltue attuiqlteu
attuiqlute attuiqluet attuiqleut attuiqletu attuiqulte attuiqulet attuiqutle attuiqutel attuiquetl attuiquelt attuiqelut
attuiqeltu attuiqeult attuiqeutl attuiqetul attuiqetlu attuiutqle attuiutqel attuiutlqe attuiutleq attuiutelq attuiuteql
attuiuqtle attuiuqtel attuiuqlte attuiuqlet attuiuqelt attuiuqetl attuiulqte attuiulqet attuiultqe attuiulteq attuiuletq
attuiuleqt attuiueqlt attuiueqtl attuiuelqt attuiueltq attuiuetlq attuiuetql attuietqul attuietqlu attuietuql attuietulq
attuietluq attuietlqu attuieqtul attuieqtlu attuiequtl attuieqult attuieqlut attuieqltu attuieuqtl attuieuqlt attuieutql
attuieutlq attuieultq attuieulqt attuielqut attuielqtu attuieluqt attuielutq attuieltuq attuieltqu attutilque attutilqeu
attutiluqe attutilueq attutileuq attutilequ attutiqlue attutiqleu attutiqule attutiquel attutiqeul attutiqelu attutiuqle
attutiuqel attutiulqe attutiuleq attutiuelq attutiueql attutiequl attutieqlu attutieuql attutieulq attutieluq attutielqu
attutlique attutliqeu attutliuqe attutliueq attutlieuq attutliequ attutlqiue attutlqieu attutlquie attutlquei attutlqeui
attutlqeiu attutluqie attutluqei attutluiqe attutluieq attutlueiq attutlueqi attutlequi attutleqiu attutleuqi attutleuiq
attutleiuq attutleiqu attutqliue attutqlieu attutqluie attutqluei attutqleui attutqleiu attutqilue attutqileu attutqiule
attutqiuel attutqieul attutqielu attutquile attutquiel attutqulie attutqulei attutqueli attutqueil attutqeiul attutqeilu
attutqeuil attutqeuli attutqelui attutqeliu attutulqie attutulqei attutuliqe attutulieq attutuleiq attutuleqi attutuqlie
attutuqlei attutuqile attutuqiel attutuqeil attutuqeli attutuiqle attutuiqel attutuilqe attutuileq attutuielq attutuieql
attutueqil attutueqli attutueiql attutueilq attutueliq attutuelqi attutelqui attutelqiu attuteluqi attuteluiq attuteliuq
attuteliqu attuteqlui attuteqliu attutequli attutequil attuteqiul attuteqilu attuteuqli attuteuqil attuteulqi attuteuliq
attuteuilq attuteuiql attuteiqul attuteiqlu attuteiuql attuteiulq attuteiluq attuteilqu attuqitlue attuqitleu attuqitule
attuqituel attuqiteul attuqitelu attuqiltue attuqilteu attuqilute attuqiluet attuqileut attuqiletu attuqiulte attuqiulet
attuqiutle attuqiutel attuqiuetl attuqiuelt attuqielut attuqieltu attuqieult attuqieutl attuqietul attuqietlu attuqtilue
attuqtileu attuqtiule attuqtiuel attuqtieul attuqtielu attuqtliue attuqtlieu attuqtluie attuqtluei attuqtleui attuqtleiu
attuqtulie attuqtulei attuqtuile attuqtuiel attuqtueil attuqtueli attuqtelui attuqteliu attuqteuli attuqteuil attuqteiul
attuqteilu attuqltiue attuqltieu attuqltuie attuqltuei attuqlteui attuqlteiu attuqlitue attuqliteu attuqliute attuqliuet
attuqlieut attuqlietu attuqluite attuqluiet attuqlutie attuqlutei attuqlueti attuqlueit attuqleiut attuqleitu attuqleuit
attuqleuti attuqletui attuqletiu attuqutlie attuqutlei attuqutile attuqutiel attuquteil attuquteli attuqultie attuqultei
attuqulite attuquliet attuquleit attuquleti attuquilte attuquilet attuquitle attuquitel attuquietl attuquielt attuquelit
attuquelti attuqueilt attuqueitl attuquetil attuquetli attuqetlui attuqetliu attuqetuli attuqetuil attuqetiul attuqetilu
attuqeltui attuqeltiu attuqeluti attuqeluit attuqeliut attuqelitu attuqeulti attuqeulit attuqeutli attuqeutil attuqeuitl
attuqeuilt attuqeilut attuqeiltu attuqeiult attuqeiutl attuqeitul attuqeitlu attuuitqle attuuitqel attuuitlqe attuuitleq
attuuitelq attuuiteql attuuiqtle attuuiqtel attuuiqlte attuuiqlet attuuiqelt attuuiqetl attuuilqte attuuilqet attuuiltqe
attuuilteq attuuiletq attuuileqt attuuieqlt attuuieqtl attuuielqt attuuieltq attuuietlq attuuietql attuutiqle attuutiqel
attuutilqe attuutileq attuutielq attuutieql attuutqile attuutqiel attuutqlie attuutqlei attuutqeli attuutqeil attuutlqie
attuutlqei attuutliqe attuutlieq attuutleiq attuutleqi attuuteqli attuuteqil attuutelqi attuuteliq attuuteilq attuuteiql
attuuqtile attuuqtiel attuuqtlie attuuqtlei attuuqteli attuuqteil attuuqitle attuuqitel attuuqilte attuuqilet attuuqielt
attuuqietl attuuqlite attuuqliet attuuqltie attuuqltei attuuqleti attuuqleit attuuqeilt attuuqeitl attuuqelit attuuqelti
attuuqetli attuuqetil attuultqie attuultqei attuultiqe attuultieq attuulteiq attuulteqi attuulqtie attuulqtei attuulqite
attuulqiet attuulqeit attuulqeti attuuliqte attuuliqet attuulitqe attuuliteq attuulietq attuulieqt attuuleqit attuuleqti
attuuleiqt attuuleitq attuuletiq attuuletqi attuuetqli attuuetqil attuuetlqi attuuetliq attuuetilq attuuetiql attuueqtli
attuueqtil attuueqlti attuueqlit attuueqilt attuueqitl attuuelqti attuuelqit attuueltqi attuueltiq attuuelitq attuueliqt
attuueiqlt attuueiqtl attuueilqt attuueiltq attuueitlq attuueitql attueitqul attueitqlu attueituql attueitulq attueitluq
attueitlqu attueiqtul attueiqtlu attueiqutl attueiqult attueiqlut attueiqltu attueiuqtl attueiuqlt attueiutql attueiutlq
attueiultq attueiulqt attueilqut attueilqtu attueiluqt attueilutq attueiltuq attueiltqu attuetiqul attuetiqlu attuetiuql
attuetiulq attuetiluq attuetilqu attuetqiul attuetqilu attuetquil attuetquli attuetqlui attuetqliu attuetuqil attuetuqli
attuetuiql attuetuilq attuetuliq attuetulqi attuetlqui attuetlqiu attuetluqi attuetluiq attuetliuq attuetliqu attueqtiul
attueqtilu attueqtuil attueqtuli attueqtlui attueqtliu attueqitul attueqitlu attueqiutl attueqiult attueqilut attueqiltu
attuequitl attuequilt attuequtil attuequtli attuequlti attuequlit attueqliut attueqlitu attueqluit attueqluti attueqltui
attueqltiu attueutqil attueutqli attueutiql attueutilq attueutliq attueutlqi attueuqtil attueuqtli attueuqitl attueuqilt
attueuqlit attueuqlti attueuiqtl attueuiqlt attueuitql attueuitlq attueuiltq attueuilqt attueulqit attueulqti attueuliqt
attueulitq attueultiq attueultqi attueltqui attueltqiu attueltuqi attueltuiq attueltiuq attueltiqu attuelqtui attuelqtiu
attuelquti attuelquit attuelqiut attuelqitu attueluqti attueluqit attuelutqi attuelutiq attueluitq attueluiqt attueliqut
attueliqtu attueliuqt attueliutq attuelituq attuelitqu attluitque attluitqeu attluituqe attluitueq attluiteuq attluitequ
attluiqtue attluiqteu attluiqute attluiquet attluiqeut attluiqetu attluiuqte attluiuqet attluiutqe attluiuteq attluiuetq
attluiueqt attluiequt attluieqtu attluieuqt attluieutq attluietuq attluietqu attlutique attlutiqeu attlutiuqe attlutiueq
attlutieuq attlutiequ attlutqiue attlutqieu attlutquie attlutquei attlutqeui attlutqeiu attlutuqie attlutuqei attlutuiqe
attlutuieq attlutueiq attlutueqi attlutequi attluteqiu attluteuqi attluteuiq attluteiuq attluteiqu attluqtiue attluqtieu
attluqtuie attluqtuei attluqteui attluqteiu attluqitue attluqiteu attluqiute attluqiuet attluqieut attluqietu attluquite
attluquiet attluqutie attluqutei attluqueti attluqueit attluqeiut attluqeitu attluqeuit attluqeuti attluqetui attluqetiu
attluutqie attluutqei attluutiqe attluutieq attluuteiq attluuteqi attluuqtie attluuqtei attluuqite attluuqiet attluuqeit
attluuqeti attluuiqte attluuiqet attluuitqe attluuiteq attluuietq attluuieqt attluueqit attluueqti attluueiqt attluueitq
attluuetiq attluuetqi attluetqui attluetqiu attluetuqi attluetuiq attluetiuq attluetiqu attlueqtui attlueqtiu attluequti
attluequit attlueqiut attlueqitu attlueuqti attlueuqit attlueutqi attlueutiq attlueuitq attlueuiqt attlueiqut attlueiqtu
attlueiuqt attlueiutq attlueituq attlueitqu attliutque attliutqeu attliutuqe attliutueq attliuteuq attliutequ attliuqtue
attliuqteu attliuqute attliuquet attliuqeut attliuqetu attliuuqte attliuuqet attliuutqe attliuuteq attliuuetq attliuueqt
attliuequt attliueqtu attliueuqt attliueutq attliuetuq attliuetqu attlituque attlituqeu attlituuqe attlituueq attlitueuq
attlituequ attlitquue attlitqueu attlitquue attlitqueu attlitqeuu attlitqeuu attlituque attlituqeu attlituuqe attlituueq
attlitueuq attlituequ attlitequu attlitequu attliteuqu attliteuuq attliteuuq attliteuqu attliqtuue attliqtueu attliqtuue
attliqtueu attliqteuu attliqteuu attliqutue attliquteu attliquute attliquuet attliqueut attliquetu attliquute attliquuet
attliqutue attliquteu attliquetu attliqueut attliqeuut attliqeutu attliqeuut attliqeutu attliqetuu attliqetuu attliutque
attliutqeu attliutuqe attliutueq attliuteuq attliutequ attliuqtue attliuqteu attliuqute attliuquet attliuqeut attliuqetu
attliuuqte attliuuqet attliuutqe attliuuteq attliuuetq attliuueqt attliuequt attliueqtu attliueuqt attliueutq attliuetuq
attliuetqu attlietquu attlietquu attlietuqu attlietuuq attlietuuq attlietuqu attlieqtuu attlieqtuu attliequtu attliequut
attliequut attliequtu attlieuqtu attlieuqut attlieutqu attlieutuq attlieuutq attlieuuqt attlieuqut attlieuqtu attlieuuqt
attlieuutq attlieutuq attlieutqu attltiuque attltiuqeu attltiuuqe attltiuueq attltiueuq attltiuequ attltiquue attltiqueu
attltiquue attltiqueu attltiqeuu attltiqeuu attltiuque attltiuqeu attltiuuqe attltiuueq attltiueuq attltiuequ attltiequu
attltiequu attltieuqu attltieuuq attltieuuq attltieuqu attltuique attltuiqeu attltuiuqe attltuiueq attltuieuq attltuiequ
attltuqiue attltuqieu attltuquie attltuquei attltuqeui attltuqeiu attltuuqie attltuuqei attltuuiqe attltuuieq attltuueiq
attltuueqi attltuequi attltueqiu attltueuqi attltueuiq attltueiuq attltueiqu attltquiue attltquieu attltquuie attltquuei
attltqueui attltqueiu attltqiuue attltqiueu attltqiuue attltqiueu attltqieuu attltqieuu attltquiue attltquieu attltquuie
attltquuei attltqueui attltqueiu attltqeiuu attltqeiuu attltqeuiu attltqeuui attltqeuui attltqeuiu attltuuqie attltuuqei
attltuuiqe attltuuieq attltuueiq attltuueqi attltuquie attltuquei attltuqiue attltuqieu attltuqeiu attltuqeui attltuique
attltuiqeu attltuiuqe attltuiueq attltuieuq attltuiequ attltueqiu attltuequi attltueiqu attltueiuq attltueuiq attltueuqi
attlteuqui attlteuqiu attlteuuqi attlteuuiq attlteuiuq attlteuiqu attltequui attltequiu attltequui attltequiu attlteqiuu
attlteqiuu attlteuqui attlteuqiu attlteuuqi attlteuuiq attlteuiuq attlteuiqu attlteiquu attlteiquu attlteiuqu attlteiuuq
attlteiuuq attlteiuqu attlqituue attlqitueu attlqituue attlqitueu attlqiteuu attlqiteuu attlqiutue attlqiuteu attlqiuute
attlqiuuet attlqiueut attlqiuetu attlqiuute attlqiuuet attlqiutue attlqiuteu attlqiuetu attlqiueut attlqieuut attlqieutu
attlqieuut attlqieutu attlqietuu attlqietuu attlqtiuue attlqtiueu attlqtiuue attlqtiueu attlqtieuu attlqtieuu attlqtuiue
attlqtuieu attlqtuuie attlqtuuei attlqtueui attlqtueiu attlqtuuie attlqtuuei attlqtuiue attlqtuieu attlqtueiu attlqtueui
attlqteuui attlqteuiu attlqteuui attlqteuiu attlqteiuu attlqteiuu attlqutiue attlqutieu attlqutuie attlqutuei attlquteui
attlquteiu attlquitue attlquiteu attlquiute attlquiuet attlquieut attlquietu attlquuite attlquuiet attlquutie attlquutei
attlquueti attlquueit attlqueiut attlqueitu attlqueuit attlqueuti attlquetui attlquetiu attlqutuie attlqutuei attlqutiue
attlqutieu attlquteiu attlquteui attlquutie attlquutei attlquuite attlquuiet attlquueit attlquueti attlquiute attlquiuet
attlquitue attlquiteu attlquietu attlquieut attlqueuit attlqueuti attlqueiut attlqueitu attlquetiu attlquetui attlqetuui
attlqetuiu attlqetuui attlqetuiu attlqetiuu attlqetiuu attlqeutui attlqeutiu attlqeuuti attlqeuuit attlqeuiut attlqeuitu
attlqeuuti attlqeuuit attlqeutui attlqeutiu attlqeuitu attlqeuiut attlqeiuut attlqeiutu attlqeiuut attlqeiutu attlqeituu
attlqeituu attluitque attluitqeu attluituqe attluitueq attluiteuq attluitequ attluiqtue attluiqteu attluiqute attluiquet
attluiqeut attluiqetu attluiuqte attluiuqet attluiutqe attluiuteq attluiuetq attluiueqt attluiequt attluieqtu attluieuqt
attluieutq attluietuq attluietqu attlutique attlutiqeu attlutiuqe attlutiueq attlutieuq attlutiequ attlutqiue attlutqieu
attlutquie attlutquei attlutqeui attlutqeiu attlutuqie attlutuqei attlutuiqe attlutuieq attlutueiq attlutueqi attlutequi
attluteqiu attluteuqi attluteuiq attluteiuq attluteiqu attluqtiue attluqtieu attluqtuie attluqtuei attluqteui attluqteiu
attluqitue attluqiteu attluqiute attluqiuet attluqieut attluqietu attluquite attluquiet attluqutie attluqutei attluqueti
attluqueit attluqeiut attluqeitu attluqeuit attluqeuti attluqetui attluqetiu attluutqie attluutqei attluutiqe attluutieq
attluuteiq attluuteqi attluuqtie attluuqtei attluuqite attluuqiet attluuqeit attluuqeti attluuiqte attluuiqet attluuitqe
attluuiteq attluuietq attluuieqt attluueqit attluueqti attluueiqt attluueitq attluuetiq attluuetqi attluetqui attluetqiu
attluetuqi attluetuiq attluetiuq attluetiqu attlueqtui attlueqtiu attluequti attluequit attlueqiut attlueqitu attlueuqti
attlueuqit attlueutqi attlueutiq attlueuitq attlueuiqt attlueiqut attlueiqtu attlueiuqt attlueiutq attlueituq attlueitqu
attleitquu attleitquu attleituqu attleituuq attleituuq attleituqu attleiqtuu attleiqtuu attleiqutu attleiquut attleiquut
attleiqutu attleiuqtu attleiuqut attleiutqu attleiutuq attleiuutq attleiuuqt attleiuqut attleiuqtu attleiuuqt attleiuutq
attleiutuq attleiutqu attletiquu attletiquu attletiuqu attletiuuq attletiuuq attletiuqu attletqiuu attletqiuu attletquiu
attletquui attletquui attletquiu attletuqiu attletuqui attletuiqu attletuiuq attletuuiq attletuuqi attletuqui attletuqiu
attletuuqi attletuuiq attletuiuq attletuiqu attleqtiuu attleqtiuu attleqtuiu attleqtuui attleqtuui attleqtuiu attleqituu
attleqituu attleqiutu attleqiuut attleqiuut attleqiutu attlequitu attlequiut attlequtiu attlequtui attlequuti attlequuit
attlequiut attlequitu attlequuit attlequuti attlequtui attlequtiu attleutqiu attleutqui attleutiqu attleutiuq attleutuiq
attleutuqi attleuqtiu attleuqtui attleuqitu attleuqiut attleuquit attleuquti attleuiqtu attleuiqut attleuitqu attleuituq
attleuiutq attleuiuqt attleuuqit attleuuqti attleuuiqt attleuuitq attleuutiq attleuutqi attleutqui attleutqiu attleutuqi
attleutuiq attleutiuq attleutiqu attleuqtui attleuqtiu attleuquti attleuquit attleuqiut attleuqitu attleuuqti attleuuqit
attleuutqi attleuutiq attleuuitq attleuuiqt attleuiqut attleuiqtu attleuiuqt attleuiutq attleuituq attleuitqu attilutque
attilutqeu attilutuqe attilutueq attiluteuq attilutequ attiluqtue attiluqteu attiluqute attiluquet attiluqeut attiluqetu
attiluuqte attiluuqet attiluutqe attiluuteq attiluuetq attiluueqt attiluequt attilueqtu attilueuqt attilueutq attiluetuq
attiluetqu attiltuque attiltuqeu attiltuuqe attiltuueq attiltueuq attiltuequ attiltquue attiltqueu attiltquue attiltqueu
attiltqeuu attiltqeuu attiltuque attiltuqeu attiltuuqe attiltuueq attiltueuq attiltuequ attiltequu attiltequu attilteuqu
attilteuuq attilteuuq attilteuqu attilqtuue attilqtueu attilqtuue attilqtueu attilqteuu attilqteuu attilqutue attilquteu
attilquute attilquuet attilqueut attilquetu attilquute attilquuet attilqutue attilquteu attilquetu attilqueut attilqeuut
attilqeutu attilqeuut attilqeutu attilqetuu attilqetuu attilutque attilutqeu attilutuqe attilutueq attiluteuq attilutequ
attiluqtue attiluqteu attiluqute attiluquet attiluqeut attiluqetu attiluuqte attiluuqet attiluutqe attiluuteq attiluuetq
attiluueqt attiluequt attilueqtu attilueuqt attilueutq attiluetuq attiluetqu attiletquu attiletquu attiletuqu attiletuuq
attiletuuq attiletuqu attileqtuu attileqtuu attilequtu attilequut attilequut attilequtu attileuqtu attileuqut attileutqu
attileutuq attileuutq attileuuqt attileuqut attileuqtu attileuuqt attileuutq attileutuq attileutqu attiultque attiultqeu
attiultuqe attiultueq attiulteuq attiultequ attiulqtue attiulqteu attiulqute attiulquet attiulqeut attiulqetu attiuluqte
attiuluqet attiulutqe attiuluteq attiuluetq attiulueqt attiulequt attiuleqtu attiuleuqt attiuleutq attiuletuq attiuletqu
attiutlque attiutlqeu attiutluqe attiutlueq attiutleuq attiutlequ attiutqlue attiutqleu attiutqule attiutquel attiutqeul
attiutqelu attiutuqle attiutuqel attiutulqe attiutuleq attiutuelq attiutueql attiutequl attiuteqlu attiuteuql attiuteulq
attiuteluq attiutelqu attiuqtlue attiuqtleu attiuqtule attiuqtuel attiuqteul attiuqtelu attiuqltue attiuqlteu attiuqlute
attiuqluet attiuqleut attiuqletu attiuqulte attiuqulet attiuqutle attiuqutel attiuquetl attiuquelt attiuqelut attiuqeltu
attiuqeult attiuqeutl attiuqetul attiuqetlu attiuutqle attiuutqel attiuutlqe attiuutleq attiuutelq attiuuteql attiuuqtle
attiuuqtel attiuuqlte attiuuqlet attiuuqelt attiuuqetl attiuulqte attiuulqet attiuultqe attiuulteq attiuuletq attiuuleqt
attiuueqlt attiuueqtl attiuuelqt attiuueltq attiuuetlq attiuuetql attiuetqul attiuetqlu attiuetuql attiuetulq attiuetluq
attiuetlqu attiueqtul attiueqtlu attiuequtl attiueqult attiueqlut attiueqltu attiueuqtl attiueuqlt attiueutql attiueutlq
attiueultq attiueulqt attiuelqut attiuelqtu attiueluqt attiuelutq attiueltuq attiueltqu attitulque attitulqeu attituluqe
attitulueq attituleuq attitulequ attituqlue attituqleu attituqule attituquel attituqeul attituqelu attituuqle attituuqel
attituulqe attituuleq attituuelq attituueql attituequl attitueqlu attitueuql attitueulq attitueluq attituelqu attitluque
attitluqeu attitluuqe attitluueq attitlueuq attitluequ attitlquue attitlqueu attitlquue attitlqueu attitlqeuu attitlqeuu
attitluque attitluqeu attitluuqe attitluueq attitlueuq attitluequ attitlequu attitlequu attitleuqu attitleuuq attitleuuq
attitleuqu attitqluue attitqlueu attitqluue attitqlueu attitqleuu attitqleuu attitqulue attitquleu attitquule attitquuel
attitqueul attitquelu attitquule attitquuel attitqulue attitquleu attitquelu attitqueul attitqeuul attitqeulu attitqeuul
attitqeulu attitqeluu attitqeluu attitulque attitulqeu attituluqe attitulueq attituleuq attitulequ attituqlue attituqleu
attituqule attituquel attituqeul attituqelu attituuqle attituuqel attituulqe attituuleq attituuelq attituueql attituequl
attitueqlu attitueuql attitueulq attitueluq attituelqu attitelquu attitelquu attiteluqu attiteluuq attiteluuq attiteluqu
attiteqluu attiteqluu attitequlu attitequul attitequul attitequlu attiteuqlu attiteuqul attiteulqu attiteuluq attiteuulq
attiteuuql attiteuqul attiteuqlu attiteuuql attiteuulq attiteuluq attiteulqu attiqutlue attiqutleu attiqutule attiqutuel
attiquteul attiqutelu attiqultue attiqulteu attiqulute attiquluet attiquleut attiquletu attiquulte attiquulet attiquutle
attiquutel attiquuetl attiquuelt attiquelut attiqueltu attiqueult attiqueutl attiquetul attiquetlu attiqtulue attiqtuleu
attiqtuule attiqtuuel attiqtueul attiqtuelu attiqtluue attiqtlueu attiqtluue attiqtlueu attiqtleuu attiqtleuu attiqtulue
attiqtuleu attiqtuule attiqtuuel attiqtueul attiqtuelu attiqteluu attiqteluu attiqteulu attiqteuul attiqteuul attiqteulu
attiqltuue attiqltueu attiqltuue attiqltueu attiqlteuu attiqlteuu attiqlutue attiqluteu attiqluute attiqluuet attiqlueut
attiqluetu attiqluute attiqluuet attiqlutue attiqluteu attiqluetu attiqlueut attiqleuut attiqleutu attiqleuut attiqleutu
attiqletuu attiqletuu attiqutlue attiqutleu attiqutule attiqutuel attiquteul attiqutelu attiqultue attiqulteu attiqulute
attiquluet attiquleut attiquletu attiquulte attiquulet attiquutle attiquutel attiquuetl attiquuelt attiquelut attiqueltu
attiqueult attiqueutl attiquetul attiquetlu attiqetluu attiqetluu attiqetulu attiqetuul attiqetuul attiqetulu attiqeltuu
attiqeltuu attiqelutu attiqeluut attiqeluut attiqelutu attiqeultu attiqeulut attiqeutlu attiqeutul attiqeuutl attiqeuult
attiqeulut attiqeultu attiqeuult attiqeuutl attiqeutul attiqeutlu attiuutqle attiuutqel attiuutlqe attiuutleq attiuutelq
attiuuteql attiuuqtle attiuuqtel attiuuqlte attiuuqlet attiuuqelt attiuuqetl attiuulqte attiuulqet attiuultqe attiuulteq
attiuuletq attiuuleqt attiuueqlt attiuueqtl attiuuelqt attiuueltq attiuuetlq attiuuetql attiutuqle attiutuqel attiutulqe
attiutuleq attiutuelq attiutueql attiutqule attiutquel attiutqlue attiutqleu attiutqelu attiutqeul attiutlque attiutlqeu
attiutluqe attiutlueq attiutleuq attiutlequ attiuteqlu attiutequl attiutelqu attiuteluq attiuteulq attiuteuql attiuqtule
attiuqtuel attiuqtlue attiuqtleu attiuqtelu attiuqteul attiuqutle attiuqutel attiuqulte attiuqulet attiuquelt attiuquetl
attiuqlute attiuqluet attiuqltue attiuqlteu attiuqletu attiuqleut attiuqeult attiuqeutl attiuqelut attiuqeltu attiuqetlu
attiuqetul attiultque attiultqeu attiultuqe attiultueq attiulteuq attiultequ attiulqtue attiulqteu attiulqute attiulquet
attiulqeut attiulqetu attiuluqte attiuluqet attiulutqe attiuluteq attiuluetq attiulueqt attiulequt attiuleqtu attiuleuqt
attiuleutq attiuletuq attiuletqu attiuetqlu attiuetqul attiuetlqu attiuetluq attiuetulq attiuetuql attiueqtlu attiueqtul
attiueqltu attiueqlut attiueqult attiuequtl attiuelqtu attiuelqut attiueltqu attiueltuq attiuelutq attiueluqt attiueuqlt
attiueuqtl attiueulqt attiueultq attiueutlq attiueutql attieutqul attieutqlu attieutuql attieutulq attieutluq attieutlqu
attieuqtul attieuqtlu attieuqutl attieuqult attieuqlut attieuqltu attieuuqtl attieuuqlt attieuutql attieuutlq attieuultq
attieuulqt attieulqut attieulqtu attieuluqt attieulutq attieultuq attieultqu attietuqul attietuqlu attietuuql attietuulq
attietuluq attietulqu attietquul attietqulu attietquul attietqulu attietqluu attietqluu attietuqul attietuqlu attietuuql
attietuulq attietuluq attietulqu attietlquu attietlquu attietluqu attietluuq attietluuq attietluqu attieqtuul attieqtulu
attieqtuul attieqtulu attieqtluu attieqtluu attiequtul attiequtlu attiequutl attiequult attiequlut attiequltu attiequutl
attiequult attiequtul attiequtlu attiequltu attiequlut attieqluut attieqlutu attieqluut attieqlutu attieqltuu attieqltuu
attieutqul attieutqlu attieutuql attieutulq attieutluq attieutlqu attieuqtul attieuqtlu attieuqutl attieuqult attieuqlut
attieuqltu attieuuqtl attieuuqlt attieuutql attieuutlq attieuultq attieuulqt attieulqut attieulqtu attieuluqt attieulutq
attieultuq attieultqu attieltquu attieltquu attieltuqu attieltuuq attieltuuq attieltuqu attielqtuu attielqtuu attielqutu
attielquut attielquut attielqutu attieluqtu attieluqut attielutqu attielutuq attieluutq attieluuqt attieluqut attieluqtu
attieluuqt attieluutq attielutuq attielutqu atttliuque atttliuqeu atttliuuqe atttliuueq atttliueuq atttliuequ atttliquue
atttliqueu atttliquue atttliqueu atttliqeuu atttliqeuu atttliuque atttliuqeu atttliuuqe atttliuueq atttliueuq atttliuequ
atttliequu atttliequu atttlieuqu atttlieuuq atttlieuuq atttlieuqu atttluique atttluiqeu atttluiuqe atttluiueq atttluieuq
atttluiequ atttluqiue atttluqieu atttluquie atttluquei atttluqeui atttluqeiu atttluuqie atttluuqei atttluuiqe atttluuieq
atttluueiq atttluueqi atttluequi atttlueqiu atttlueuqi atttlueuiq atttlueiuq atttlueiqu atttlquiue atttlquieu atttlquuie
atttlquuei atttlqueui atttlqueiu atttlqiuue atttlqiueu atttlqiuue atttlqiueu atttlqieuu atttlqieuu atttlquiue atttlquieu
atttlquuie atttlquuei atttlqueui atttlqueiu atttlqeiuu atttlqeiuu atttlqeuiu atttlqeuui atttlqeuui atttlqeuiu atttluuqie
atttluuqei atttluuiqe atttluuieq atttluueiq atttluueqi atttluquie atttluquei atttluqiue atttluqieu atttluqeiu atttluqeui
atttluique atttluiqeu atttluiuqe atttluiueq atttluieuq atttluiequ atttlueqiu atttluequi atttlueiqu atttlueiuq atttlueuiq
atttlueuqi atttleuqui atttleuqiu atttleuuqi atttleuuiq atttleuiuq atttleuiqu atttlequui atttlequiu atttlequui atttlequiu
atttleqiuu atttleqiuu atttleuqui atttleuqiu atttleuuqi atttleuuiq atttleuiuq atttleuiqu atttleiquu atttleiquu atttleiuqu
atttleiuuq atttleiuuq atttleiuqu atttiluque atttiluqeu atttiluuqe atttiluueq atttilueuq atttiluequ atttilquue atttilqueu
atttilquue atttilqueu atttilqeuu atttilqeuu atttiluque atttiluqeu atttiluuqe atttiluueq atttilueuq atttiluequ atttilequu
atttilequu atttileuqu atttileuuq atttileuuq atttileuqu atttiulque atttiulqeu atttiuluqe atttiulueq atttiuleuq atttiulequ
atttiuqlue atttiuqleu atttiuqule atttiuquel atttiuqeul atttiuqelu atttiuuqle atttiuuqel atttiuulqe atttiuuleq atttiuuelq
atttiuueql atttiuequl atttiueqlu atttiueuql atttiueulq atttiueluq atttiuelqu atttiqulue atttiquleu atttiquule atttiquuel
atttiqueul atttiquelu atttiqluue atttiqlueu atttiqluue atttiqlueu atttiqleuu atttiqleuu atttiqulue atttiquleu atttiquule
atttiquuel atttiqueul atttiquelu atttiqeluu atttiqeluu atttiqeulu atttiqeuul atttiqeuul atttiqeulu atttiuuqle atttiuuqel
atttiuulqe atttiuuleq atttiuuelq atttiuueql atttiuqule atttiuquel atttiuqlue atttiuqleu atttiuqelu atttiuqeul atttiulque
atttiulqeu atttiuluqe atttiulueq atttiuleuq atttiulequ atttiueqlu atttiuequl atttiuelqu atttiueluq atttiueulq atttiueuql
atttieuqul atttieuqlu atttieuuql atttieuulq atttieuluq atttieulqu atttiequul atttiequlu atttiequul atttiequlu atttieqluu
atttieqluu atttieuqul atttieuqlu atttieuuql atttieuulq atttieuluq atttieulqu atttielquu atttielquu atttieluqu atttieluuq
atttieluuq atttieluqu atttuilque atttuilqeu atttuiluqe atttuilueq atttuileuq atttuilequ atttuiqlue atttuiqleu atttuiqule
atttuiquel atttuiqeul atttuiqelu atttuiuqle atttuiuqel atttuiulqe atttuiuleq atttuiuelq atttuiueql atttuiequl atttuieqlu
atttuieuql atttuieulq atttuieluq atttuielqu atttulique atttuliqeu atttuliuqe atttuliueq atttulieuq atttuliequ atttulqiue
atttulqieu atttulquie atttulquei atttulqeui atttulqeiu atttuluqie atttuluqei atttuluiqe atttuluieq atttulueiq atttulueqi
atttulequi atttuleqiu atttuleuqi atttuleuiq atttuleiuq atttuleiqu atttuqliue atttuqlieu atttuqluie atttuqluei atttuqleui
atttuqleiu atttuqilue atttuqileu atttuqiule atttuqiuel atttuqieul atttuqielu atttuquile atttuquiel atttuqulie atttuqulei
atttuqueli atttuqueil atttuqeiul atttuqeilu atttuqeuil atttuqeuli atttuqelui atttuqeliu atttuulqie atttuulqei atttuuliqe
atttuulieq atttuuleiq atttuuleqi atttuuqlie atttuuqlei atttuuqile atttuuqiel atttuuqeil atttuuqeli atttuuiqle atttuuiqel
atttuuilqe atttuuileq atttuuielq atttuuieql atttuueqil atttuueqli atttuueiql atttuueilq atttuueliq atttuuelqi atttuelqui
atttuelqiu atttueluqi atttueluiq atttueliuq atttueliqu atttueqlui atttueqliu atttuequli atttuequil atttueqiul atttueqilu
atttueuqli atttueuqil atttueulqi atttueuliq atttueuilq atttueuiql atttueiqul atttueiqlu atttueiuql atttueiulq atttueiluq
atttueilqu atttqiulue atttqiuleu atttqiuule atttqiuuel atttqiueul atttqiuelu atttqiluue atttqilueu atttqiluue atttqilueu
atttqileuu atttqileuu atttqiulue atttqiuleu atttqiuule atttqiuuel atttqiueul atttqiuelu atttqieluu atttqieluu atttqieulu
atttqieuul atttqieuul atttqieulu atttquilue atttquileu atttquiule atttquiuel atttquieul atttquielu atttquliue atttqulieu
atttquluie atttquluei atttquleui atttquleiu atttquulie atttquulei atttquuile atttquuiel atttquueil atttquueli atttquelui
atttqueliu atttqueuli atttqueuil atttqueiul atttqueilu atttqluiue atttqluieu atttqluuie atttqluuei atttqlueui atttqlueiu
atttqliuue atttqliueu atttqliuue atttqliueu atttqlieuu atttqlieuu atttqluiue atttqluieu atttqluuie atttqluuei atttqlueui
atttqlueiu atttqleiuu atttqleiuu atttqleuiu atttqleuui atttqleuui atttqleuiu atttquulie atttquulei atttquuile atttquuiel
atttquueil atttquueli atttquluie atttquluei atttquliue atttqulieu atttquleiu atttquleui atttquilue atttquileu atttquiule
atttquiuel atttquieul atttquielu atttqueliu atttquelui atttqueilu atttqueiul atttqueuil atttqueuli atttqeului atttqeuliu
atttqeuuli atttqeuuil atttqeuiul atttqeuilu atttqeluui atttqeluiu atttqeluui atttqeluiu atttqeliuu atttqeliuu atttqeului
atttqeuliu atttqeuuli atttqeuuil atttqeuiul atttqeuilu atttqeiluu atttqeiluu atttqeiulu atttqeiuul atttqeiuul atttqeiulu
atttuiuqle atttuiuqel atttuiulqe atttuiuleq atttuiuelq atttuiueql atttuiqule atttuiquel atttuiqlue atttuiqleu atttuiqelu
atttuiqeul atttuilque atttuilqeu atttuiluqe atttuilueq atttuileuq atttuilequ atttuieqlu atttuiequl atttuielqu atttuieluq
atttuieulq atttuieuql atttuuiqle atttuuiqel atttuuilqe atttuuileq atttuuielq atttuuieql atttuuqile atttuuqiel atttuuqlie
atttuuqlei atttuuqeli atttuuqeil atttuulqie atttuulqei atttuuliqe atttuulieq atttuuleiq atttuuleqi atttuueqli atttuueqil
atttuuelqi atttuueliq atttuueilq atttuueiql atttuquile atttuquiel atttuqulie atttuqulei atttuqueli atttuqueil atttuqiule
atttuqiuel atttuqilue atttuqileu atttuqielu atttuqieul atttuqliue atttuqlieu atttuqluie atttuqluei atttuqleui atttuqleiu
atttuqeilu atttuqeiul atttuqeliu atttuqelui atttuqeuli atttuqeuil atttuluqie atttuluqei atttuluiqe atttuluieq atttulueiq
atttulueqi atttulquie atttulquei atttulqiue atttulqieu atttulqeiu atttulqeui atttulique atttuliqeu atttuliuqe atttuliueq
atttulieuq atttuliequ atttuleqiu atttulequi atttuleiqu atttuleiuq atttuleuiq atttuleuqi atttueuqli atttueuqil atttueulqi
atttueuliq atttueuilq atttueuiql atttuequli atttuequil atttueqlui atttueqliu atttueqilu atttueqiul atttuelqui atttuelqiu
atttueluqi atttueluiq atttueliuq atttueliqu atttueiqlu atttueiqul atttueilqu atttueiluq atttueiulq atttueiuql attteiuqul
attteiuqlu attteiuuql attteiuulq attteiuluq attteiulqu attteiquul attteiqulu attteiquul attteiqulu attteiqluu attteiqluu
attteiuqul attteiuqlu attteiuuql attteiuulq attteiuluq attteiulqu attteilquu attteilquu attteiluqu attteiluuq attteiluuq
attteiluqu attteuiqul attteuiqlu attteuiuql attteuiulq attteuiluq attteuilqu attteuqiul attteuqilu attteuquil attteuquli
attteuqlui attteuqliu attteuuqil attteuuqli attteuuiql attteuuilq attteuuliq attteuulqi attteulqui attteulqiu attteuluqi
attteuluiq attteuliuq attteuliqu atttequiul atttequilu atttequuil atttequuli attteqului atttequliu attteqiuul attteqiulu
attteqiuul attteqiulu attteqiluu attteqiluu atttequiul atttequilu atttequuil atttequuli attteqului atttequliu attteqliuu
attteqliuu attteqluiu attteqluui attteqluui attteqluiu attteuuqil attteuuqli attteuuiql attteuuilq attteuuliq attteuulqi
attteuquil attteuquli attteuqiul attteuqilu attteuqliu attteuqlui attteuiqul attteuiqlu attteuiuql attteuiulq attteuiluq
attteuilqu attteulqiu attteulqui attteuliqu attteuliuq attteuluiq attteuluqi attteluqui attteluqiu attteluuqi attteluuiq
attteluiuq attteluiqu atttelquui atttelquiu atttelquui atttelquiu atttelqiuu atttelqiuu attteluqui attteluqiu attteluuqi
attteluuiq attteluiuq attteluiqu attteliquu attteliquu attteliuqu attteliuuq attteliuuq attteliuqu attqlituue attqlitueu
attqlituue attqlitueu attqliteuu attqliteuu attqliutue attqliuteu attqliuute attqliuuet attqliueut attqliuetu attqliuute
attqliuuet attqliutue attqliuteu attqliuetu attqliueut attqlieuut attqlieutu attqlieuut attqlieutu attqlietuu attqlietuu
attqltiuue attqltiueu attqltiuue attqltiueu attqltieuu attqltieuu attqltuiue attqltuieu attqltuuie attqltuuei attqltueui
attqltueiu attqltuuie attqltuuei attqltuiue attqltuieu attqltueiu attqltueui attqlteuui attqlteuiu attqlteuui attqlteuiu
attqlteiuu attqlteiuu attqlutiue attqlutieu attqlutuie attqlutuei attqluteui attqluteiu attqluitue attqluiteu attqluiute
attqluiuet attqluieut attqluietu attqluuite attqluuiet attqluutie attqluutei attqluueti attqluueit attqlueiut attqlueitu
attqlueuit attqlueuti attqluetui attqluetiu attqlutuie attqlutuei attqlutiue attqlutieu attqluteiu attqluteui attqluutie
attqluutei attqluuite attqluuiet attqluueit attqluueti attqluiute attqluiuet attqluitue attqluiteu attqluietu attqluieut
attqlueuit attqlueuti attqlueiut attqlueitu attqluetiu attqluetui attqletuui attqletuiu attqletuui attqletuiu attqletiuu
attqletiuu attqleutui attqleutiu attqleuuti attqleuuit attqleuiut attqleuitu attqleuuti attqleuuit attqleutui attqleutiu
attqleuitu attqleuiut attqleiuut attqleiutu attqleiuut attqleiutu attqleituu attqleituu attqiltuue attqiltueu attqiltuue
attqiltueu attqilteuu attqilteuu attqilutue attqiluteu attqiluute attqiluuet attqilueut attqiluetu attqiluute attqiluuet
attqilutue attqiluteu attqiluetu attqilueut attqileuut attqileutu attqileuut attqileutu attqiletuu attqiletuu attqitluue
attqitlueu attqitluue attqitlueu attqitleuu attqitleuu attqitulue attqituleu attqituule attqituuel attqitueul attqituelu
attqituule attqituuel attqitulue attqituleu attqituelu attqitueul attqiteuul attqiteulu attqiteuul attqiteulu attqiteluu
attqiteluu attqiutlue attqiutleu attqiutule attqiutuel attqiuteul attqiutelu attqiultue attqiulteu attqiulute attqiuluet
attqiuleut attqiuletu attqiuulte attqiuulet attqiuutle attqiuutel attqiuuetl attqiuuelt attqiuelut attqiueltu attqiueult
attqiueutl attqiuetul attqiuetlu attqiutule attqiutuel attqiutlue attqiutleu attqiutelu attqiuteul attqiuutle attqiuutel
attqiuulte attqiuulet attqiuuelt attqiuuetl attqiulute attqiuluet attqiultue attqiulteu attqiuletu attqiuleut attqiueult
attqiueutl attqiuelut attqiueltu attqiuetlu attqiuetul attqietuul attqietulu attqietuul attqietulu attqietluu attqietluu
attqieutul attqieutlu attqieuutl attqieuult attqieulut attqieultu attqieuutl attqieuult attqieutul attqieutlu attqieultu
attqieulut attqieluut attqielutu attqieluut attqielutu attqieltuu attqieltuu attqtiluue attqtilueu attqtiluue attqtilueu
attqtileuu attqtileuu attqtiulue attqtiuleu attqtiuule attqtiuuel attqtiueul attqtiuelu attqtiuule attqtiuuel attqtiulue
attqtiuleu attqtiuelu attqtiueul attqtieuul attqtieulu attqtieuul attqtieulu attqtieluu attqtieluu attqtliuue attqtliueu
attqtliuue attqtliueu attqtlieuu attqtlieuu attqtluiue attqtluieu attqtluuie attqtluuei attqtlueui attqtlueiu attqtluuie
attqtluuei attqtluiue attqtluieu attqtlueiu attqtlueui attqtleuui attqtleuiu attqtleuui attqtleuiu attqtleiuu attqtleiuu
attqtuliue attqtulieu attqtuluie attqtuluei attqtuleui attqtuleiu attqtuilue attqtuileu attqtuiule attqtuiuel attqtuieul
attqtuielu attqtuuile attqtuuiel attqtuulie attqtuulei attqtuueli attqtuueil attqtueiul attqtueilu attqtueuil attqtueuli
attqtuelui attqtueliu attqtuluie attqtuluei attqtuliue attqtulieu attqtuleiu attqtuleui attqtuulie attqtuulei attqtuuile
attqtuuiel attqtuueil attqtuueli attqtuiule attqtuiuel attqtuilue attqtuileu attqtuielu attqtuieul attqtueuil attqtueuli
attqtueiul attqtueilu attqtueliu attqtuelui attqteluui attqteluiu attqteluui attqteluiu attqteliuu attqteliuu attqteului
attqteuliu attqteuuli attqteuuil attqteuiul attqteuilu attqteuuli attqteuuil attqteului attqteuliu attqteuilu attqteuiul
attqteiuul attqteiulu attqteiuul attqteiulu attqteiluu attqteiluu attquitlue attquitleu attquitule attquituel attquiteul
attquitelu attquiltue attquilteu attquilute attquiluet attquileut attquiletu attquiulte attquiulet attquiutle attquiutel
attquiuetl attquiuelt attquielut attquieltu attquieult attquieutl attquietul attquietlu attqutilue attqutileu attqutiule
attqutiuel attqutieul attqutielu attqutliue attqutlieu attqutluie attqutluei attqutleui attqutleiu attqutulie attqutulei
attqutuile attqutuiel attqutueil attqutueli attqutelui attquteliu attquteuli attquteuil attquteiul attquteilu attqultiue
attqultieu attqultuie attqultuei attqulteui attqulteiu attqulitue attquliteu attquliute attquliuet attqulieut attqulietu
attquluite attquluiet attqulutie attqulutei attqulueti attqulueit attquleiut attquleitu attquleuit attquleuti attquletui
attquletiu attquutlie attquutlei attquutile attquutiel attquuteil attquuteli attquultie attquultei attquulite attquuliet
attquuleit attquuleti attquuilte attquuilet attquuitle attquuitel attquuietl attquuielt attquuelit attquuelti attquueilt
attquueitl attquuetil attquuetli attquetlui attquetliu attquetuli attquetuil attquetiul attquetilu attqueltui attqueltiu
attqueluti attqueluit attqueliut attquelitu attqueulti attqueulit attqueutli attqueutil attqueuitl attqueuilt attqueilut
attqueiltu attqueiult attqueiutl attqueitul attqueitlu attquitule attquituel attquitlue attquitleu attquitelu attquiteul
attquiutle attquiutel attquiulte attquiulet attquiuelt attquiuetl attquilute attquiluet attquiltue attquilteu attquiletu
attquileut attquieult attquieutl attquielut attquieltu attquietlu attquietul attqutiule attqutiuel attqutilue attqutileu
attqutielu attqutieul attqutuile attqutuiel attqutulie attqutulei attqutueli attqutueil attqutluie attqutluei attqutliue
attqutlieu attqutleiu attqutleui attquteuli attquteuil attqutelui attquteliu attquteilu attquteiul attquutile attquutiel
attquutlie attquutlei attquuteli attquuteil attquuitle attquuitel attquuilte attquuilet attquuielt attquuietl attquulite
attquuliet attquultie attquultei attquuleti attquuleit attquueilt attquueitl attquuelit attquuelti attquuetli attquuetil
attqultuie attqultuei attqultiue attqultieu attqulteiu attqulteui attqulutie attqulutei attquluite attquluiet attqulueit
attqulueti attquliute attquliuet attqulitue attquliteu attqulietu attqulieut attquleuit attquleuti attquleiut attquleitu
attquletiu attquletui attquetuli attquetuil attquetlui attquetliu attquetilu attquetiul attqueutli attqueutil attqueulti
attqueulit attqueuilt attqueuitl attqueluti attqueluit attqueltui attqueltiu attquelitu attqueliut attqueiult attqueiutl
attqueilut attqueiltu attqueitlu attqueitul attqeituul attqeitulu attqeituul attqeitulu attqeitluu attqeitluu attqeiutul
attqeiutlu attqeiuutl attqeiuult attqeiulut attqeiultu attqeiuutl attqeiuult attqeiutul attqeiutlu attqeiultu attqeiulut
attqeiluut attqeilutu attqeiluut attqeilutu attqeiltuu attqeiltuu attqetiuul attqetiulu attqetiuul attqetiulu attqetiluu
attqetiluu attqetuiul attqetuilu attqetuuil attqetuuli attqetului attqetuliu attqetuuil attqetuuli attqetuiul attqetuilu
attqetuliu attqetului attqetluui attqetluiu attqetluui attqetluiu attqetliuu attqetliuu attqeutiul attqeutilu attqeutuil
attqeutuli attqeutlui attqeutliu attqeuitul attqeuitlu attqeuiutl attqeuiult attqeuilut attqeuiltu attqeuuitl attqeuuilt
attqeuutil attqeuutli attqeuulti attqeuulit attqeuliut attqeulitu attqeuluit attqeuluti attqeultui attqeultiu attqeutuil
attqeutuli attqeutiul attqeutilu attqeutliu attqeutlui attqeuutil attqeuutli attqeuuitl attqeuuilt attqeuulit attqeuulti
attqeuiutl attqeuiult attqeuitul attqeuitlu attqeuiltu attqeuilut attqeuluit attqeuluti attqeuliut attqeulitu attqeultiu
attqeultui attqeltuui attqeltuiu attqeltuui attqeltuiu attqeltiuu attqeltiuu attqelutui attqelutiu attqeluuti attqeluuit
attqeluiut attqeluitu attqeluuti attqeluuit attqelutui attqelutiu attqeluitu attqeluiut attqeliuut attqeliutu attqeliuut
attqeliutu attqelituu attqelituu attulitque attulitqeu attulituqe attulitueq attuliteuq attulitequ attuliqtue attuliqteu
attuliqute attuliquet attuliqeut attuliqetu attuliuqte attuliuqet attuliutqe attuliuteq attuliuetq attuliueqt attuliequt
attulieqtu attulieuqt attulieutq attulietuq attulietqu attultique attultiqeu attultiuqe attultiueq attultieuq attultiequ
attultqiue attultqieu attultquie attultquei attultqeui attultqeiu attultuqie attultuqei attultuiqe attultuieq attultueiq
attultueqi attultequi attulteqiu attulteuqi attulteuiq attulteiuq attulteiqu attulqtiue attulqtieu attulqtuie attulqtuei
attulqteui attulqteiu attulqitue attulqiteu attulqiute attulqiuet attulqieut attulqietu attulquite attulquiet attulqutie
attulqutei attulqueti attulqueit attulqeiut attulqeitu attulqeuit attulqeuti attulqetui attulqetiu attulutqie attulutqei
attulutiqe attulutieq attuluteiq attuluteqi attuluqtie attuluqtei attuluqite attuluqiet attuluqeit attuluqeti attuluiqte
attuluiqet attuluitqe attuluiteq attuluietq attuluieqt attulueqit attulueqti attulueiqt attulueitq attuluetiq attuluetqi
attuletqui attuletqiu attuletuqi attuletuiq attuletiuq attuletiqu attuleqtui attuleqtiu attulequti attulequit attuleqiut
attuleqitu attuleuqti attuleuqit attuleutqi attuleutiq attuleuitq attuleuiqt attuleiqut attuleiqtu attuleiuqt attuleiutq
attuleituq attuleitqu attuiltque attuiltqeu attuiltuqe attuiltueq attuilteuq attuiltequ attuilqtue attuilqteu attuilqute
attuilquet attuilqeut attuilqetu attuiluqte attuiluqet attuilutqe attuiluteq attuiluetq attuilueqt attuilequt attuileqtu
attuileuqt attuileutq attuiletuq attuiletqu attuitlque attuitlqeu attuitluqe attuitlueq attuitleuq attuitlequ attuitqlue
attuitqleu attuitqule attuitquel attuitqeul attuitqelu attuituqle attuituqel attuitulqe attuituleq attuituelq attuitueql
attuitequl attuiteqlu attuiteuql attuiteulq attuiteluq attuitelqu attuiqtlue attuiqtleu attuiqtule attuiqtuel attuiqteul
attuiqtelu attuiqltue attuiqlteu attuiqlute attuiqluet attuiqleut attuiqletu attuiqulte attuiqulet attuiqutle attuiqutel
attuiquetl attuiquelt attuiqelut attuiqeltu attuiqeult attuiqeutl attuiqetul attuiqetlu attuiutqle attuiutqel attuiutlqe
attuiutleq attuiutelq attuiuteql attuiuqtle attuiuqtel attuiuqlte attuiuqlet attuiuqelt attuiuqetl attuiulqte attuiulqet
attuiultqe attuiulteq attuiuletq attuiuleqt attuiueqlt attuiueqtl attuiuelqt attuiueltq attuiuetlq attuiuetql attuietqul
attuietqlu attuietuql attuietulq attuietluq attuietlqu attuieqtul attuieqtlu attuiequtl attuieqult attuieqlut attuieqltu
attuieuqtl attuieuqlt attuieutql attuieutlq attuieultq attuieulqt attuielqut attuielqtu attuieluqt attuielutq attuieltuq
attuieltqu attutilque attutilqeu attutiluqe attutilueq attutileuq attutilequ attutiqlue attutiqleu attutiqule attutiquel
attutiqeul attutiqelu attutiuqle attutiuqel attutiulqe attutiuleq attutiuelq attutiueql attutiequl attutieqlu attutieuql
attutieulq attutieluq attutielqu attutlique attutliqeu attutliuqe attutliueq attutlieuq attutliequ attutlqiue attutlqieu
attutlquie attutlquei attutlqeui attutlqeiu attutluqie attutluqei attutluiqe attutluieq attutlueiq attutlueqi attutlequi
attutleqiu attutleuqi attutleuiq attutleiuq attutleiqu attutqliue attutqlieu attutqluie attutqluei attutqleui attutqleiu
attutqilue attutqileu attutqiule attutqiuel attutqieul attutqielu attutquile attutquiel attutqulie attutqulei attutqueli
attutqueil attutqeiul attutqeilu attutqeuil attutqeuli attutqelui attutqeliu attutulqie attutulqei attutuliqe attutulieq
attutuleiq attutuleqi attutuqlie attutuqlei attutuqile attutuqiel attutuqeil attutuqeli attutuiqle attutuiqel attutuilqe
attutuileq attutuielq attutuieql attutueqil attutueqli attutueiql attutueilq attutueliq attutuelqi attutelqui attutelqiu
attuteluqi attuteluiq attuteliuq attuteliqu attuteqlui attuteqliu attutequli attutequil attuteqiul attuteqilu attuteuqli
attuteuqil attuteulqi attuteuliq attuteuilq attuteuiql attuteiqul attuteiqlu attuteiuql attuteiulq attuteiluq attuteilqu
attuqitlue attuqitleu attuqitule attuqituel attuqiteul attuqitelu attuqiltue attuqilteu attuqilute attuqiluet attuqileut
attuqiletu attuqiulte attuqiulet attuqiutle attuqiutel attuqiuetl attuqiuelt attuqielut attuqieltu attuqieult attuqieutl
attuqietul attuqietlu attuqtilue attuqtileu attuqtiule attuqtiuel attuqtieul attuqtielu attuqtliue attuqtlieu attuqtluie
attuqtluei attuqtleui attuqtleiu attuqtulie attuqtulei attuqtuile attuqtuiel attuqtueil attuqtueli attuqtelui attuqteliu
attuqteuli attuqteuil attuqteiul attuqteilu attuqltiue attuqltieu attuqltuie attuqltuei attuqlteui attuqlteiu attuqlitue
attuqliteu attuqliute attuqliuet attuqlieut attuqlietu attuqluite attuqluiet attuqlutie attuqlutei attuqlueti attuqlueit
attuqleiut attuqleitu attuqleuit attuqleuti attuqletui attuqletiu attuqutlie attuqutlei attuqutile attuqutiel attuquteil
attuquteli attuqultie attuqultei attuqulite attuquliet attuquleit attuquleti attuquilte attuquilet attuquitle attuquitel
attuquietl attuquielt attuquelit attuquelti attuqueilt attuqueitl attuquetil attuquetli attuqetlui attuqetliu attuqetuli
attuqetuil attuqetiul attuqetilu attuqeltui attuqeltiu attuqeluti attuqeluit attuqeliut attuqelitu attuqeulti attuqeulit
attuqeutli attuqeutil attuqeuitl attuqeuilt attuqeilut attuqeiltu attuqeiult attuqeiutl attuqeitul attuqeitlu attuuitqle
attuuitqel attuuitlqe attuuitleq attuuitelq attuuiteql attuuiqtle attuuiqtel attuuiqlte attuuiqlet attuuiqelt attuuiqetl
attuuilqte attuuilqet attuuiltqe attuuilteq attuuiletq attuuileqt attuuieqlt attuuieqtl attuuielqt attuuieltq attuuietlq
attuuietql attuutiqle attuutiqel attuutilqe attuutileq attuutielq attuutieql attuutqile attuutqiel attuutqlie attuutqlei
attuutqeli attuutqeil attuutlqie attuutlqei attuutliqe attuutlieq attuutleiq attuutleqi attuuteqli attuuteqil attuutelqi
attuuteliq attuuteilq attuuteiql attuuqtile attuuqtiel attuuqtlie attuuqtlei attuuqteli attuuqteil attuuqitle attuuqitel
attuuqilte attuuqilet attuuqielt attuuqietl attuuqlite attuuqliet attuuqltie attuuqltei attuuqleti attuuqleit attuuqeilt
attuuqeitl attuuqelit attuuqelti attuuqetli attuuqetil attuultqie attuultqei attuultiqe attuultieq attuulteiq attuulteqi
attuulqtie attuulqtei attuulqite attuulqiet attuulqeit attuulqeti attuuliqte attuuliqet attuulitqe attuuliteq attuulietq
attuulieqt attuuleqit attuuleqti attuuleiqt attuuleitq attuuletiq attuuletqi attuuetqli attuuetqil attuuetlqi attuuetliq
attuuetilq attuuetiql attuueqtli attuueqtil attuueqlti attuueqlit attuueqilt attuueqitl attuuelqti attuuelqit attuueltqi
attuueltiq attuuelitq attuueliqt attuueiqlt attuueiqtl attuueilqt attuueiltq attuueitlq attuueitql attueitqul attueitqlu
attueituql attueitulq attueitluq attueitlqu attueiqtul attueiqtlu attueiqutl attueiqult attueiqlut attueiqltu attueiuqtl
attueiuqlt attueiutql attueiutlq attueiultq attueiulqt attueilqut attueilqtu attueiluqt attueilutq attueiltuq attueiltqu
attuetiqul attuetiqlu attuetiuql attuetiulq attuetiluq attuetilqu attuetqiul attuetqilu attuetquil attuetquli attuetqlui
attuetqliu attuetuqil attuetuqli attuetuiql attuetuilq attuetuliq attuetulqi attuetlqui attuetlqiu attuetluqi attuetluiq
attuetliuq attuetliqu attueqtiul attueqtilu attueqtuil attueqtuli attueqtlui attueqtliu attueqitul attueqitlu attueqiutl
attueqiult attueqilut attueqiltu attuequitl attuequilt attuequtil attuequtli attuequlti attuequlit attueqliut attueqlitu
attueqluit attueqluti attueqltui attueqltiu attueutqil attueutqli attueutiql attueutilq attueutliq attueutlqi attueuqtil
attueuqtli attueuqitl attueuqilt attueuqlit attueuqlti attueuiqtl attueuiqlt attueuitql attueuitlq attueuiltq attueuilqt
attueulqit attueulqti attueuliqt attueulitq attueultiq attueultqi attueltqui attueltqiu attueltuqi attueltuiq attueltiuq
attueltiqu attuelqtui attuelqtiu attuelquti attuelquit attuelqiut attuelqitu attueluqti attueluqit attuelutqi attuelutiq
attueluitq attueluiqt attueliqut attueliqtu attueliuqt attueliutq attuelituq attuelitqu attelitquu attelitquu attelituqu
attelituuq attelituuq attelituqu atteliqtuu atteliqtuu atteliqutu atteliquut atteliquut atteliqutu atteliuqtu atteliuqut
atteliutqu atteliutuq atteliuutq atteliuuqt atteliuqut atteliuqtu atteliuuqt atteliuutq atteliutuq atteliutqu atteltiquu
atteltiquu atteltiuqu atteltiuuq atteltiuuq atteltiuqu atteltqiuu atteltqiuu atteltquiu atteltquui atteltquui atteltquiu
atteltuqiu atteltuqui atteltuiqu atteltuiuq atteltuuiq atteltuuqi atteltuqui atteltuqiu atteltuuqi atteltuuiq atteltuiuq
atteltuiqu attelqtiuu attelqtiuu attelqtuiu attelqtuui attelqtuui attelqtuiu attelqituu attelqituu attelqiutu attelqiuut
attelqiuut attelqiutu attelquitu attelquiut attelqutiu attelqutui attelquuti attelquuit attelquiut attelquitu attelquuit
attelquuti attelqutui attelqutiu attelutqiu attelutqui attelutiqu attelutiuq attelutuiq attelutuqi atteluqtiu atteluqtui
atteluqitu atteluqiut atteluquit atteluquti atteluiqtu atteluiqut atteluitqu atteluituq atteluiutq atteluiuqt atteluuqit
atteluuqti atteluuiqt atteluuitq atteluutiq atteluutqi attelutqui attelutqiu attelutuqi attelutuiq attelutiuq attelutiqu
atteluqtui atteluqtiu atteluquti atteluquit atteluqiut atteluqitu atteluuqti atteluuqit atteluutqi atteluutiq atteluuitq
atteluuiqt atteluiqut atteluiqtu atteluiuqt atteluiutq atteluituq atteluitqu atteiltquu atteiltquu atteiltuqu atteiltuuq
atteiltuuq atteiltuqu atteilqtuu atteilqtuu atteilqutu atteilquut atteilquut atteilqutu atteiluqtu atteiluqut atteilutqu
atteilutuq atteiluutq atteiluuqt atteiluqut atteiluqtu atteiluuqt atteiluutq atteilutuq atteilutqu atteitlquu atteitlquu
atteitluqu atteitluuq atteitluuq atteitluqu atteitqluu atteitqluu atteitqulu atteitquul atteitquul atteitqulu atteituqlu
atteituqul atteitulqu atteituluq atteituulq atteituuql atteituqul atteituqlu atteituuql atteituulq atteituluq atteitulqu
atteiqtluu atteiqtluu atteiqtulu atteiqtuul atteiqtuul atteiqtulu atteiqltuu atteiqltuu atteiqlutu atteiqluut atteiqluut
atteiqlutu atteiqultu atteiqulut atteiqutlu atteiqutul atteiquutl atteiquult atteiqulut atteiqultu atteiquult atteiquutl
atteiqutul atteiqutlu atteiutqlu atteiutqul atteiutlqu atteiutluq atteiutulq atteiutuql atteiuqtlu atteiuqtul atteiuqltu
atteiuqlut atteiuqult atteiuqutl atteiulqtu atteiulqut atteiultqu atteiultuq atteiulutq atteiuluqt atteiuuqlt atteiuuqtl
atteiuulqt atteiuultq atteiuutlq atteiuutql atteiutqul atteiutqlu atteiutuql atteiutulq atteiutluq atteiutlqu atteiuqtul
atteiuqtlu atteiuqutl atteiuqult atteiuqlut atteiuqltu atteiuuqtl atteiuuqlt atteiuutql atteiuutlq atteiuultq atteiuulqt
atteiulqut atteiulqtu atteiuluqt atteiulutq atteiultuq atteiultqu attetilquu attetilquu attetiluqu attetiluuq attetiluuq
attetiluqu attetiqluu attetiqluu attetiqulu attetiquul attetiquul attetiqulu attetiuqlu attetiuqul attetiulqu attetiuluq
attetiuulq attetiuuql attetiuqul attetiuqlu attetiuuql attetiuulq attetiuluq attetiulqu attetliquu attetliquu attetliuqu
attetliuuq attetliuuq attetliuqu attetlqiuu attetlqiuu attetlquiu attetlquui attetlquui attetlquiu attetluqiu attetluqui
attetluiqu attetluiuq attetluuiq attetluuqi attetluqui attetluqiu attetluuqi attetluuiq attetluiuq attetluiqu attetqliuu
attetqliuu attetqluiu attetqluui attetqluui attetqluiu attetqiluu attetqiluu attetqiulu attetqiuul attetqiuul attetqiulu
attetquilu attetquiul attetquliu attetqului attetquuli attetquuil attetquiul attetquilu attetquuil attetquuli attetqului
attetquliu attetulqiu attetulqui attetuliqu attetuliuq attetuluiq attetuluqi attetuqliu attetuqlui attetuqilu attetuqiul
attetuquil attetuquli attetuiqlu attetuiqul attetuilqu attetuiluq attetuiulq attetuiuql attetuuqil attetuuqli attetuuiql
attetuuilq attetuuliq attetuulqi attetulqui attetulqiu attetuluqi attetuluiq attetuliuq attetuliqu attetuqlui attetuqliu
attetuquli attetuquil attetuqiul attetuqilu attetuuqli attetuuqil attetuulqi attetuuliq attetuuilq attetuuiql attetuiqul
attetuiqlu attetuiuql attetuiulq attetuiluq attetuilqu atteqitluu atteqitluu atteqitulu atteqituul atteqituul atteqitulu
atteqiltuu atteqiltuu atteqilutu atteqiluut atteqiluut atteqilutu atteqiultu atteqiulut atteqiutlu atteqiutul atteqiuutl
atteqiuult atteqiulut atteqiultu atteqiuult atteqiuutl atteqiutul atteqiutlu atteqtiluu atteqtiluu atteqtiulu atteqtiuul
atteqtiuul atteqtiulu atteqtliuu atteqtliuu atteqtluiu atteqtluui atteqtluui atteqtluiu atteqtuliu atteqtului atteqtuilu
atteqtuiul atteqtuuil atteqtuuli atteqtului atteqtuliu atteqtuuli atteqtuuil atteqtuiul atteqtuilu atteqltiuu atteqltiuu
atteqltuiu atteqltuui atteqltuui atteqltuiu atteqlituu atteqlituu atteqliutu atteqliuut atteqliuut atteqliutu atteqluitu
atteqluiut atteqlutiu atteqlutui atteqluuti atteqluuit atteqluiut atteqluitu atteqluuit atteqluuti atteqlutui atteqlutiu
attequtliu attequtlui attequtilu attequtiul attequtuil attequtuli attequltiu attequltui attequlitu attequliut attequluit
attequluti attequiltu attequilut attequitlu attequitul attequiutl attequiult attequulit attequulti attequuilt attequuitl
attequutil attequutli attequtlui attequtliu attequtuli attequtuil attequtiul attequtilu attequltui attequltiu attequluti
attequluit attequliut attequlitu attequulti attequulit attequutli attequutil attequuitl attequuilt attequilut attequiltu
attequiult attequiutl attequitul attequitlu atteuitqlu atteuitqul atteuitlqu atteuitluq atteuitulq atteuituql atteuiqtlu
atteuiqtul atteuiqltu atteuiqlut atteuiqult atteuiqutl atteuilqtu atteuilqut atteuiltqu atteuiltuq atteuilutq atteuiluqt
atteuiuqlt atteuiuqtl atteuiulqt atteuiultq atteuiutlq atteuiutql atteutiqlu atteutiqul atteutilqu atteutiluq atteutiulq
atteutiuql atteutqilu atteutqiul atteutqliu atteutqlui atteutquli atteutquil atteutlqiu atteutlqui atteutliqu atteutliuq
atteutluiq atteutluqi atteutuqli atteutuqil atteutulqi atteutuliq atteutuilq atteutuiql atteuqtilu atteuqtiul atteuqtliu
atteuqtlui atteuqtuli atteuqtuil atteuqitlu atteuqitul atteuqiltu atteuqilut atteuqiult atteuqiutl atteuqlitu atteuqliut
atteuqltiu atteuqltui atteuqluti atteuqluit atteuquilt atteuquitl atteuqulit atteuqulti atteuqutli atteuqutil atteultqiu
atteultqui atteultiqu atteultiuq atteultuiq atteultuqi atteulqtiu atteulqtui atteulqitu atteulqiut atteulquit atteulquti
atteuliqtu atteuliqut atteulitqu atteulituq atteuliutq atteuliuqt atteuluqit atteuluqti atteuluiqt atteuluitq atteulutiq
atteulutqi atteuutqli atteuutqil atteuutlqi atteuutliq atteuutilq atteuutiql atteuuqtli atteuuqtil atteuuqlti atteuuqlit
atteuuqilt atteuuqitl atteuulqti atteuulqit atteuultqi atteuultiq atteuulitq atteuuliqt atteuuiqlt atteuuiqtl atteuuilqt
atteuuiltq atteuuitlq atteuuitql atteuitqul atteuitqlu atteuituql atteuitulq atteuitluq atteuitlqu atteuiqtul atteuiqtlu
atteuiqutl atteuiqult atteuiqlut atteuiqltu atteuiuqtl atteuiuqlt atteuiutql atteuiutlq atteuiultq atteuiulqt atteuilqut
atteuilqtu atteuiluqt atteuilutq atteuiltuq atteuiltqu atteutiqul atteutiqlu atteutiuql atteutiulq atteutiluq atteutilqu
atteutqiul atteutqilu atteutquil atteutquli atteutqlui atteutqliu atteutuqil atteutuqli atteutuiql atteutuilq atteutuliq
atteutulqi atteutlqui atteutlqiu atteutluqi atteutluiq atteutliuq atteutliqu atteuqtiul atteuqtilu atteuqtuil atteuqtuli
atteuqtlui atteuqtliu atteuqitul atteuqitlu atteuqiutl atteuqiult atteuqilut atteuqiltu atteuquitl atteuquilt atteuqutil
atteuqutli atteuqulti atteuqulit atteuqliut atteuqlitu atteuqluit atteuqluti atteuqltui atteuqltiu atteuutqil atteuutqli
atteuutiql atteuutilq atteuutliq atteuutlqi atteuuqtil atteuuqtli atteuuqitl atteuuqilt atteuuqlit atteuuqlti atteuuiqtl
atteuuiqlt atteuuitql atteuuitlq atteuuiltq atteuuilqt atteuulqit atteuulqti atteuuliqt atteuulitq atteuultiq atteuultqi
atteultqui atteultqiu atteultuqi atteultuiq atteultiuq atteultiqu atteulqtui atteulqtiu atteulquti atteulquit atteulqiut
atteulqitu atteuluqti atteuluqit atteulutqi atteulutiq atteuluitq atteuluiqt atteuliqut atteuliqtu atteuliuqt atteuliutq
atteulituq atteulitqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us