easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

nazifies

sealery

subimposed

gristlier

transports

wikmanson

corpuscle

litania

naeger

verteres

shackanite

unexperiential

ulciscimur

disagreed

scourgeth

troca

voglio

adiponitrile


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: atmans
cipher variations:
bunbot cvocpu dwpdqv exqerw fyrfsx
gzsgty hathuz ibuiva jcvjwb kdwkxc
lexlyd mfymze ngznaf ohaobg pibpch
qjcqdi rkdrej slesfk tmftgl unguhm
vohvin wpiwjo xqjxkp yrkylq zslzmr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: atmans
Cipher: zgnzmh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: atmans
Cipher: AAAAA BAABA ABABB AAAAA ABBAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: atmans
cipher variations:
bunbotbglbodbsjbonbehboxbqfbohbcdborbazbolbmxbov
byvbofbktbopbwrbozbipbojcvocpuchmcpectkcpocficpy
crgcpicdecpscbacpmcnycpwczwcpgclucpqcxscpacjqcpk
dwpdqvdindqfduldqpdgjdqzdshdqjdefdqtdcbdqndozdqx
daxdqhdmvdqrdytdqbdkrdqlexqerwejoergevmerqehkera
etierkefgeruedceroepaeryebyerienwersezuercelserm
fyrfsxfkpfshfwnfsrfilfsbfujfslfghfsvfedfspfqbfsz
fczfsjfoxfstfavfsdfmtfsngzsgtyglqgtigxogtsgjmgtc
gvkgtmghigtwgfegtqgrcgtagdagtkgpygtugbwgtegnugto
hathuzhmrhujhyphuthknhudhwlhunhijhuxhgfhurhsdhub
hebhulhqzhuvhcxhufhovhupibuivainsivkizqivuiloive
ixmivoijkivyihgivsiteivcifcivmiraivwidyivgipwivq
jcvjwbjotjwljarjwvjmpjwfjynjwpjkljwzjihjwtjufjwd
jgdjwnjsbjwxjezjwhjqxjwrkdwkxckpukxmkbskxwknqkxg
kzokxqklmkxakjikxukvgkxekhekxoktckxykfakxikrykxs
lexlydlqvlynlctlyxlorlyhlaplyrlmnlyblkjlyvlwhlyf
liflypludlyzlgblyjlszlytmfymzemrwmzomdumzympsmzi
mbqmzsmnomzcmlkmzwmximzgmjgmzqmvemzamhcmzkmtamzu
ngznafnsxnapnevnaznqtnajncrnatnopnadnmlnaxnyjnah
nkhnarnwfnabnidnalnubnavohaobgotyobqofwobaoruobk
odsobuopqobeonmobyozkobioliobsoxgobcojeobmovcobw
pibpchpuzpcrpgxpcbpsvpclpetpcvpqrpcfponpczpalpcj
pmjpctpyhpcdpkfpcnpwdpcxqjcqdiqvaqdsqhyqdcqtwqdm
qfuqdwqrsqdgqpoqdaqbmqdkqnkqduqziqdeqlgqdoqxeqdy
rkdrejrwbretrizredruxrenrgvrexrstrehrqprebrcnrel
rolrevrajrefrmhrepryfrezslesfksxcsfusjasfesvysfo
shwsfystusfisrqsfcsdosfmspmsfwsbksfgsnisfqszgsfa
tmftgltydtgvtkbtgftwztgptixtgztuvtgjtsrtgdteptgn
tqntgxtcltghtojtgrtahtgbunguhmuzeuhwulcuhguxauhq
ujyuhauvwuhkutsuheufquhourouhyudmuhiupkuhsubiuhc
vohvinvafvixvmdvihvybvirvkzvibvwxvilvutvifvgrvip
vspvizvenvijvqlvitvcjvidwpiwjowbgwjywnewjiwzcwjs
wlawjcwxywjmwvuwjgwhswjqwtqwjawfowjkwrmwjuwdkwje
xqjxkpxchxkzxofxkjxadxktxmbxkdxyzxknxwvxkhxitxkr
xurxkbxgpxklxsnxkvxelxkfyrkylqydiylaypgylkybeylu
yncyleyzayloyxwyliyjuylsyvsylcyhqylmytoylwyfmylg
zslzmrzejzmbzqhzmlzcfzmvzodzmfzabzmpzyxzmjzkvzmt
zwtzmdzirzmnzupzmxzgnzmhatmansafkancarianmadganw
apeangabcanqazyankalwanuaxuaneajsanoavqanyahoani

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: atmans
Cipher: ngznaf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: atmans
Cipher: 114423113334

Extended Methods:
Method #1

Plaintext: atmans
method variations:
fyrfsxldwlxcqibqchvogvhn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a t m a n s 
1 4 2 1 3 3 
1 4 3 1 3 4 
They are then read out in rows:
142133143134
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: atmans
Cipher: qbnqcs

Read more ...
Method #3

Plaintext: atmans
method variations:
qiclnd iclndq clndqi
lndqic ndqicl dqicln

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: atmans

all 720 cipher variations:
atmans atmasn atmnas atmnsa atmsna atmsan atamns atamsn atanms atansm atasnm
atasmn atnams atnasm atnmas atnmsa atnsma atnsam atsanm atsamn atsnam atsnma
atsmna atsman amtans amtasn amtnas amtnsa amtsna amtsan amatns amatsn amants
amanst amasnt amastn amnats amnast amntas amntsa amnsta amnsat amsant amsatn
amsnat amsnta amstna amstan aamtns aamtsn aamnts aamnst aamsnt aamstn aatmns
aatmsn aatnms aatnsm aatsnm aatsmn aantms aantsm aanmts aanmst aansmt aanstm
aastnm aastmn aasntm aasnmt aasmnt aasmtn anmats anmast anmtas anmtsa anmsta
anmsat anamts anamst anatms anatsm anastm anasmt antams antasm antmas antmsa
antsma antsam ansatm ansamt anstam anstma ansmta ansmat asmant asmatn asmnat
asmnta asmtna asmtan asamnt asamtn asanmt asantm asatnm asatmn asnamt asnatm
asnmat asnmta asntma asntam astanm astamn astnam astnma astmna astman tamans
tamasn tamnas tamnsa tamsna tamsan taamns taamsn taanms taansm taasnm taasmn
tanams tanasm tanmas tanmsa tansma tansam tasanm tasamn tasnam tasnma tasmna
tasman tmaans tmaasn tmanas tmansa tmasna tmasan tmaans tmaasn tmanas tmansa
tmasna tmasan tmnaas tmnasa tmnaas tmnasa tmnsaa tmnsaa tmsana tmsaan tmsnaa
tmsnaa tmsana tmsaan tamans tamasn tamnas tamnsa tamsna tamsan taamns taamsn
taanms taansm taasnm taasmn tanams tanasm tanmas tanmsa tansma tansam tasanm
tasamn tasnam tasnma tasmna tasman tnmaas tnmasa tnmaas tnmasa tnmsaa tnmsaa
tnamas tnamsa tnaams tnaasm tnasam tnasma tnaams tnaasm tnamas tnamsa tnasma
tnasam tnsaam tnsama tnsaam tnsama tnsmaa tnsmaa tsmana tsmaan tsmnaa tsmnaa
tsmana tsmaan tsamna tsaman tsanma tsanam tsaanm tsaamn tsnama tsnaam tsnmaa
tsnmaa tsnama tsnaam tsaanm tsaamn tsanam tsanma tsamna tsaman mtaans mtaasn
mtanas mtansa mtasna mtasan mtaans mtaasn mtanas mtansa mtasna mtasan mtnaas
mtnasa mtnaas mtnasa mtnsaa mtnsaa mtsana mtsaan mtsnaa mtsnaa mtsana mtsaan
matans matasn matnas matnsa matsna matsan maatns maatsn maants maanst maasnt
maastn manats manast mantas mantsa mansta mansat masant masatn masnat masnta
mastna mastan maatns maatsn maants maanst maasnt maastn matans matasn matnas
matnsa matsna matsan mantas mantsa manats manast mansat mansta mastna mastan
masnta masnat masant masatn mnaats mnaast mnatas mnatsa mnasta mnasat mnaats
mnaast mnatas mnatsa mnasta mnasat mntaas mntasa mntaas mntasa mntsaa mntsaa
mnsata mnsaat mnstaa mnstaa mnsata mnsaat msaant msaatn msanat msanta msatna
msatan msaant msaatn msanat msanta msatna msatan msnaat msnata msnaat msnata
msntaa msntaa mstana mstaan mstnaa mstnaa mstana mstaan atmans atmasn atmnas
atmnsa atmsna atmsan atamns atamsn atanms atansm atasnm atasmn atnams atnasm
atnmas atnmsa atnsma atnsam atsanm atsamn atsnam atsnma atsmna atsman amtans
amtasn amtnas amtnsa amtsna amtsan amatns amatsn amants amanst amasnt amastn
amnats amnast amntas amntsa amnsta amnsat amsant amsatn amsnat amsnta amstna
amstan aamtns aamtsn aamnts aamnst aamsnt aamstn aatmns aatmsn aatnms aatnsm
aatsnm aatsmn aantms aantsm aanmts aanmst aansmt aanstm aastnm aastmn aasntm
aasnmt aasmnt aasmtn anmats anmast anmtas anmtsa anmsta anmsat anamts anamst
anatms anatsm anastm anasmt antams antasm antmas antmsa antsma antsam ansatm
ansamt anstam anstma ansmta ansmat asmant asmatn asmnat asmnta asmtna asmtan
asamnt asamtn asanmt asantm asatnm asatmn asnamt asnatm asnmat asnmta asntma
asntam astanm astamn astnam astnma astmna astman ntmaas ntmasa ntmaas ntmasa
ntmsaa ntmsaa ntamas ntamsa ntaams ntaasm ntasam ntasma ntaams ntaasm ntamas
ntamsa ntasma ntasam ntsaam ntsama ntsaam ntsama ntsmaa ntsmaa nmtaas nmtasa
nmtaas nmtasa nmtsaa nmtsaa nmatas nmatsa nmaats nmaast nmasat nmasta nmaats
nmaast nmatas nmatsa nmasta nmasat nmsaat nmsata nmsaat nmsata nmstaa nmstaa
namtas namtsa namats namast namsat namsta natmas natmsa natams natasm natsam
natsma naatms naatsm naamts naamst naasmt naastm nastam nastma nasatm nasamt
nasmat nasmta namats namast namtas namtsa namsta namsat naamts naamst naatms
naatsm naastm naasmt natams natasm natmas natmsa natsma natsam nasatm nasamt
nastam nastma nasmta nasmat nsmaat nsmata nsmaat nsmata nsmtaa nsmtaa nsamat
nsamta nsaamt nsaatm nsatam nsatma nsaamt nsaatm nsamat nsamta nsatma nsatam
nstaam nstama nstaam nstama nstmaa nstmaa stmana stmaan stmnaa stmnaa stmana
stmaan stamna staman stanma stanam staanm staamn stnama stnaam stnmaa stnmaa
stnama stnaam staanm staamn stanam stanma stamna staman smtana smtaan smtnaa
smtnaa smtana smtaan smatna smatan smanta smanat smaant smaatn smnata smnaat
smntaa smntaa smnata smnaat smaant smaatn smanat smanta smatna smatan samtna
samtan samnta samnat samant samatn satmna satman satnma satnam satanm satamn
santma santam sanmta sanmat sanamt sanatm saatnm saatmn saantm saanmt saamnt
saamtn snmata snmaat snmtaa snmtaa snmata snmaat snamta snamat snatma snatam
snaatm snaamt sntama sntaam sntmaa sntmaa sntama sntaam snaatm snaamt snatam
snatma snamta snamat samant samatn samnat samnta samtna samtan saamnt saamtn
saanmt saantm saatnm saatmn sanamt sanatm sanmat sanmta santma santam satanm
satamn satnam satnma satmna satman

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us