easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

dukesbury

rears

certabiminique

histamineum

savest

backstretches

langfitt

bassoons

cattails

actinograph

stachyuraceae

spratlin

lapham

mazzie

turnkeys

unconciliable

nonpersistence

silvani


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: arteriolosclerosis
cipher variations:
bsufsjpmptdmfsptjt ctvgtkqnquengtquku duwhulrorvfohurvlv evxivmspswgpivswmw fwyjwntqtxhqjwtxnx
gxzkxouruyirkxuyoy hyalypvsvzjslyvzpz izbmzqwtwaktmzwaqa jacnarxuxblunaxbrb kbdobsyvycmvobycsc
lcepctzwzdnwpczdtd mdfqduaxaeoxqdaeue negrevbybfpyrebfvf ofhsfwczcgqzsfcgwg pgitgxdadhratgdhxh
qhjuhyebeisbuheiyi rikvizfcfjtcvifjzj sjlwjagdgkudwjgkak tkmxkbhehlvexkhlbl ulnylcifimwfylimcm
vmozmdjgjnxgzmjndn wnpanekhkoyhankoeo xoqboflilpzibolpfp yprcpgmjmqajcpmqgq zqsdqhnknrbkdqnrhr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: arteriolosclerosis
Cipher: zigvirlolhxovilhrh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: arteriolosclerosis
Cipher: AAAAA BAAAA BAABA AABAA BAAAA ABAAA ABBAB ABABA ABBAB BAAAB AAABA ABABA AABAA BAAAA ABBAB BAAAB ABAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: arteriolosclerosis
cipher variations:
bsufsjpmptdmfsptjtbagnazrirdhinardzdbisviptetnlevitnpnbqedqfvavxpadqvxfxbyqlyvxwxhtwlyxhvhbgctglzszrxstgzrlrbwajwrdkdlfkjwdlrlbemrehfgfvjgrefvhv
bmyzmxhchfnczmhfxfbukhunjyjpryhujpnpbcwpcdlulzvupclzdzbkixktnqnjzqxknjtjctvgtkqnquengtqukucbhobasjseijobseaecjtwjqufuomfwjuoqocrfergwbwyqberwygy
czrmzwyxyiuxmzyiwichduhmatasytuhasmscxbkxselemglkxemsmcfnsfighgwkhsfgwiwcnzanyidigodanigygcvlivokzkqszivkqoqcdxqdemvmawvqdmaeacljyluorokarylokuk
duwhulrorvfohurvlvdcipcbtktfjkpctfbfdkuxkrvgvpngxkvprpdsgfshxcxzrcfsxzhzdasnaxzyzjvynazjxjdievinbubtzuvibtntdyclytfmfnhmlyfntndgotgjhihxlitghxjx
doabozjejhpebojhzhdwmjwplalrtajwlrprdeyrefnwnbxwrenbfbdmkzmvpsplbszmplvlevxivmspswgpivswmwedjqdculugklqdugcgelvylswhwqohylwqsqethgtiydyasdgtyaia
ebtobyazakwzobakykejfwjocvcuavwjcuouezdmzugngoinmzgouoehpuhkijiymjuhiykyepbcpakfkiqfcpkiaiexnkxqmbmsubkxmsqsefzsfgoxocyxsfocgcenlanwqtqmctanqmwm
fwyjwntqtxhqjwtxnxfekredvmvhlmrevhdhfmwzmtxixrpizmxrtrfuihujzezbtehuzbjbfcupczbablxapcblzlfkgxkpdwdvbwxkdvpvfaenavhohpjonahpvpfiqviljkjznkvijzlz
fqcdqblgljrgdqljbjfyolyrncntvclyntrtfgatghpypdzytgpdhdfomboxrurndubornxngxzkxouruyirkxuyoygflsfewnwimnsfwieignxanuyjysqjanysusgvjivkafacufivackc
gdvqdacbcmybqdcmamglhylqexewcxylewqwgbfobwipiqkpobiqwqgjrwjmklkaolwjkamagrdercmhmkshermkckgzpmzsodouwdmzousughbuhiqzqeazuhqeiegpncpysvsoevcpsoyo
hyalypvsvzjslyvzpzhgmtgfxoxjnotgxjfjhoybovzkztrkboztvthwkjwlbgbdvgjwbdldhewrebdcdnzcrednbnhmizmrfyfxdyzmfxrxhcgpcxjqjrlqpcjrxrhksxknlmlbpmxklbnb
hsefsdninltifsnldlhaqnatpepvxenapvtvhicvijrarfbavirfjfhqodqztwtpfwdqtpzpizbmzqwtwaktmzwaqaihnuhgypykopuhykgkipzcpwalauslcpauwuixlkxmchcewhkxceme
ifxsfcedeoadsfeocoinjansgzgyezangysyidhqdykrksmrqdksysiltylomnmcqnylmcocitfgteojomujgtomemibrobuqfqwyfobqwuwijdwjksbsgcbwjsgkgirperauxuqgxeruqaq
jacnarxuxblunaxbrbjiovihzqzlpqvizlhljqadqxbmbvtmdqbvxvjymlyndidfxilydfnfjgytgdfefpbetgfpdpjokbothahzfabohztzjeirezlsltnsreltztjmuzmpnondrozmndpd
jughufpkpnvkhupnfnjcspcvrgrxzgpcrxvxjkexkltcthdcxkthlhjsqfsbvyvrhyfsvrbrkbdobsyvycmvobycsckjpwjiaramqrwjamimkrberycncwunercwywkznmzoejegyjmzegog
khzuhegfgqcfuhgqeqkplcpuibiagbcpiauakfjsfamtmuotsfmuauknvanqopoespanoeqekvhivgqlqowlivqogokdtqdwshsyahqdsywyklfylmuduiedyluimiktrgtcwzwsizgtwscs
lcepctzwzdnwpczdtdlkqxkjbsbnrsxkbnjnlscfszdodxvofsdxzxlaonapfkfhzknafhphliavifhghrdgvihrfrlqmdqvjcjbhcdqjbvblgktgbnunvputgnvbvlowborpqpftqbopfrf
lwijwhrmrpxmjwrphpleurextitzbiretzxzlmgzmnvevjfezmvjnjlushudxaxtjahuxtdtmdfqduaxaeoxqdaeuemlrylkctcostylcokomtdgtaepeywpgteyaymbpobqglgialobgiqi
mjbwjgihisehwjisgsmrnerwkdkciderkcwcmhluhcovowqvuhowcwmpxcpsqrqgurcpqgsgmxjkxisnsqynkxsqiqmfvsfyujuacjsfuayamnhanowfwkgfanwkokmvtiveybyukbivyueu
negrevbybfpyrebfvfnmszmldudptuzmdplpnuehubfqfzxqhufzbzncqpcrhmhjbmpchjrjnkcxkhjijtfixkjthtnsofsxleldjefsldxdnimvidpwpxrwvipxdxnqydqtrsrhvsdqrhth
nyklyjtotrzolytrjrngwtgzvkvbdktgvbzbnoibopxgxlhgboxlplnwujwfzczvlcjwzvfvofhsfwczcgqzsfcgwgontanmevequvaneqmqovfivcgrgayrivgacaodrqdsinikcnqdiksk
oldylikjkugjylkuiuotpgtymfmekfgtmeyeojnwjeqxqysxwjqyeyorzerustsiwtersiuiozlmzkupusapmzusksohxuhawlwceluhwcacopjcpqyhymihcpymqmoxvkxgadawmdkxawgw
pgitgxdadhratgdhxhpoubonfwfrvwbofrnrpwgjwdhshbzsjwhbdbpesretjojldorejltlpmezmjlklvhkzmlvjvpuqhuzngnflghunfzfpkoxkfryrztyxkrzfzpsafsvtutjxufstjvj
pamnalvqvtbqnavtltpiyvibxmxdfmvixdbdpqkdqrziznjidqznrnpywlyhbebxnelybxhxqhjuhyebeisbuheiyiqpvcpogxgswxcpgsosqxhkxeiticatkxicecqftsfukpkmepsfkmum
qnfankmlmwilanmwkwqvrivaohogmhivogagqlpylgszsauzylsagaqtbgtwuvukyvgtukwkqbnobmwrwucrobwumuqjzwjcynyegnwjyeceqrlersajaokjeraosoqzxmzicfcyofmzcyiy
rikvizfcfjtcvifjzjrqwdqphyhtxydqhtptryilyfjujdbulyjdfdrgutgvlqlnfqtglnvnrogbolnmnxjmbonxlxrwsjwbpiphnijwphbhrmqzmhtatbvazmtbhbruchuxvwvlzwhuvlxl
rcopcnxsxvdspcxvnvrkaxkdzozfhoxkzfdfrsmfstbkbplkfsbptpraynajdgdzpgnadzjzsjlwjagdgkudwjgkaksrxerqiziuyzeriuquszjmzgkvkecvmzkegeshvuhwmrmogruhmowo
sphcpmonoykncpoymysxtkxcqjqiojkxqicisnraniubucwbanucicsvdivywxwmaxivwmymsdpqdoytywetqdywowslbyleapagipylagegstngtuclcqmlgtcquqsbzobkeheaqhobeaka
tkmxkbhehlvexkhlbltsyfsrjajvzafsjvrvtaknahlwlfdwnalfhftiwvixnsnphsvinpxptqidqnpopzlodqpznztyulydrkrjpklyrjdjtosbojvcvdxcbovdjdtwejwzxyxnbyjwxnzn
teqrepzuzxfurezxpxtmczmfbqbhjqzmbhfhtuohuvdmdrnmhudrvrtcapclfifbripcfblbulnylcifimwfylimcmutzgtskbkwabgtkwswublobimxmgexobmgigujxwjyotoqitwjoqyq
urjeroqpqamperqaoauzvmzeslskqlmzskekuptcpkwdweydcpwekeuxfkxayzyoczkxyoaoufrsfqavaygvsfayqyundangcrcikrancigiuvpivwenesoniveswsudbqdmgjgcsjqdgcmc
vmozmdjgjnxgzmjndnvuahutlclxbchulxtxvcmpcjnynhfypcnhjhvkyxkzpuprjuxkprzrvskfsprqrbnqfsrbpbvawnaftmtlrmnatlflvqudqlxexfzedqxflfvyglybzazpdalyzpbp
vgstgrbwbzhwtgbzrzvoebohdsdjlsbodjhjvwqjwxfoftpojwftxtvecrenhkhdtkrehdndwnpanekhkoyhankoeowvbivumdmycdivmyuywdnqdkozoigzqdoikiwlzylaqvqskvylqsas
wtlgtqsrscorgtscqcwbxobgunumsnobumgmwrvermyfygaferygmgwzhmzcabaqebmzaqcqwhtuhscxcaixuhcasawpfcpietekmtcpekikwxrkxygpguqpkxguyuwfdsfoilieulsfieoe
xoqboflilpzibolpfpxwcjwvnenzdejwnzvzxeorelpapjharepjljxmazmbrwrtlwzmrtbtxumhurtstdpshutdrdxcypchvovntopcvnhnxswfsnzgzhbgfszhnhxainadbcbrfcnabrdr
xiuvitdydbjyvidbtbxqgdqjfuflnudqfljlxyslyzhqhvrqlyhvzvxgetgpjmjfvmtgjfpfyprcpgmjmqajcpmqgqyxdkxwofoaefkxoawayfpsfmqbqkibsfqkmkynbancsxsumxansucu
yvnivsutueqtivueseydzqdiwpwoupqdwoioytxgtoahaichgtaioiybjobecdcsgdobcsesyjvwjuezeckzwjecucyrherkgvgmovergmkmyztmzairiwsrmziwawyhfuhqknkgwnuhkgqg
zqsdqhnknrbkdqnrhrzyelyxpgpbfglypbxbzgqtgnrcrljctgrlnlzocbodtytvnybotvdvzwojwtvuvfrujwvftfzearejxqxpvqrexpjpzuyhupbibjdihubjpjzckpcfdedthepcdtft
zkwxkvfafdlaxkfdvdzsifslhwhnpwfshnlnzaunabjsjxtsnajxbxzigvirlolhxovilhrharteriolosclerosisazfmzyqhqcghmzqcycahruhosdsmkduhsmomapdcpeuzuwozcpuwew
axpkxuwvwgsvkxwgugafbsfkyryqwrsfyqkqavzivqcjckejivckqkadlqdgefeuifqdeugualxylwgbgembylgeweatjgtmixioqxgtiomoabvobcktkyutobkycyajhwjsmpmiypwjmisi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: arteriolosclerosis
Cipher: negrevbybfpyrebfvf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: arteriolosclerosis
Cipher: 112444512442431343343113512443344234

Extended Methods:
Method #1

Plaintext: arteriolosclerosis
method variations:
fwykwotqtxhqkwtxoxlbdpbtyvycnvpbyctcqgiugydadhsaugdhyhvmozmdifinxfzmindn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a r t e r i o l o s c l e r o s i s 
1 2 4 5 2 4 4 1 4 3 3 1 5 2 4 3 4 3 
1 4 4 1 4 2 3 3 3 4 1 3 1 4 3 4 2 4 
They are then read out in rows:
124524414331524343144142333413143424
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: arteriolosclerosis
Cipher: fyrdockooqdinslqsr

Read more ...
Method #3

Plaintext: arteriolosclerosis
method variations:
ftyftrcsnoaxftntmd tyftrcsnoaxftntmdf yftrcsnoaxftntmdft
ftrcsnoaxftntmdfty trcsnoaxftntmdftyf rcsnoaxftntmdftyft
csnoaxftntmdftyftr snoaxftntmdftyftrc noaxftntmdftyftrcs
oaxftntmdftyftrcsn axftntmdftyftrcsno xftntmdftyftrcsnoa
ftntmdftyftrcsnoax tntmdftyftrcsnoaxf ntmdftyftrcsnoaxft
tmdftyftrcsnoaxftn mdftyftrcsnoaxftnt dftyftrcsnoaxftntm

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: arteriolosclerosis

first 5040 cipher variations(6.3728046455659E+15 total)
arteriolosclerosis arteriolosclerossi arterioloscleroiss arterioloscleroiss arteriolosclerosis arteriolosclerossi
arteriolosclersois arteriolosclersosi arteriolosclersios arteriolosclersiso arteriolosclerssio arteriolosclerssoi
arteriolosclerisos arteriolosclerisso arteriolosclerioss arteriolosclerioss arteriolosclerisos arteriolosclerisso
arteriolosclerssio arteriolosclerssoi arteriolosclersiso arteriolosclersios arteriolosclersois arteriolosclersosi
arterioloscleorsis arterioloscleorssi arterioloscleoriss arterioloscleoriss arterioloscleorsis arterioloscleorssi
arterioloscleosris arterioloscleosrsi arterioloscleosirs arterioloscleosisr arterioloscleossir arterioloscleossri
arterioloscleoisrs arterioloscleoissr arterioloscleoirss arterioloscleoirss arterioloscleoisrs arterioloscleoissr
arterioloscleossir arterioloscleossri arterioloscleosisr arterioloscleosirs arterioloscleosris arterioloscleosrsi
arteriolosclesoris arteriolosclesorsi arteriolosclesoirs arteriolosclesoisr arteriolosclesosir arteriolosclesosri
arteriolosclesrois arteriolosclesrosi arteriolosclesrios arteriolosclesriso arteriolosclesrsio arteriolosclesrsoi
arteriolosclesiros arteriolosclesirso arteriolosclesiors arteriolosclesiosr arteriolosclesisor arteriolosclesisro
arteriolosclessrio arteriolosclessroi arteriolosclessiro arteriolosclessior arteriolosclessoir arteriolosclessori
arterioloscleiosrs arterioloscleiossr arterioloscleiorss arterioloscleiorss arterioloscleiosrs arterioloscleiossr
arterioloscleisors arterioloscleisosr arterioloscleisros arterioloscleisrso arterioloscleissro arterioloscleissor
arterioloscleirsos arterioloscleirsso arterioloscleiross arterioloscleiross arterioloscleirsos arterioloscleirsso
arterioloscleissro arterioloscleissor arterioloscleisrso arterioloscleisros arterioloscleisors arterioloscleisosr
arteriolosclesosir arteriolosclesosri arteriolosclesoisr arteriolosclesoirs arteriolosclesoris arteriolosclesorsi
arteriolosclessoir arteriolosclessori arteriolosclessior arteriolosclessiro arteriolosclessrio arteriolosclessroi
arteriolosclesisor arteriolosclesisro arteriolosclesiosr arteriolosclesiors arteriolosclesiros arteriolosclesirso
arteriolosclesrsio arteriolosclesrsoi arteriolosclesriso arteriolosclesrios arteriolosclesrois arteriolosclesrosi
arteriolosclreosis arteriolosclreossi arteriolosclreoiss arteriolosclreoiss arteriolosclreosis arteriolosclreossi
arteriolosclresois arteriolosclresosi arteriolosclresios arteriolosclresiso arteriolosclressio arteriolosclressoi
arteriolosclreisos arteriolosclreisso arteriolosclreioss arteriolosclreioss arteriolosclreisos arteriolosclreisso
arteriolosclressio arteriolosclressoi arteriolosclresiso arteriolosclresios arteriolosclresois arteriolosclresosi
arteriolosclroesis arteriolosclroessi arteriolosclroeiss arteriolosclroeiss arteriolosclroesis arteriolosclroessi
arteriolosclroseis arteriolosclrosesi arteriolosclrosies arteriolosclrosise arteriolosclrossie arteriolosclrossei
arteriolosclroises arteriolosclroisse arteriolosclroiess arteriolosclroiess arteriolosclroises arteriolosclroisse
arteriolosclrossie arteriolosclrossei arteriolosclrosise arteriolosclrosies arteriolosclroseis arteriolosclrosesi
arteriolosclrsoeis arteriolosclrsoesi arteriolosclrsoies arteriolosclrsoise arteriolosclrsosie arteriolosclrsosei
arteriolosclrseois arteriolosclrseosi arteriolosclrseios arteriolosclrseiso arteriolosclrsesio arteriolosclrsesoi
arteriolosclrsieos arteriolosclrsieso arteriolosclrsioes arteriolosclrsiose arteriolosclrsisoe arteriolosclrsiseo
arteriolosclrsseio arteriolosclrsseoi arteriolosclrssieo arteriolosclrssioe arteriolosclrssoie arteriolosclrssoei
arteriolosclrioses arteriolosclriosse arteriolosclrioess arteriolosclrioess arteriolosclrioses arteriolosclriosse
arteriolosclrisoes arteriolosclrisose arteriolosclriseos arteriolosclriseso arteriolosclrisseo arteriolosclrissoe
arteriolosclriesos arteriolosclriesso arteriolosclrieoss arteriolosclrieoss arteriolosclriesos arteriolosclriesso
arteriolosclrisseo arteriolosclrissoe arteriolosclriseso arteriolosclriseos arteriolosclrisoes arteriolosclrisose
arteriolosclrsosie arteriolosclrsosei arteriolosclrsoise arteriolosclrsoies arteriolosclrsoeis arteriolosclrsoesi
arteriolosclrssoie arteriolosclrssoei arteriolosclrssioe arteriolosclrssieo arteriolosclrsseio arteriolosclrsseoi
arteriolosclrsisoe arteriolosclrsiseo arteriolosclrsiose arteriolosclrsioes arteriolosclrsieos arteriolosclrsieso
arteriolosclrsesio arteriolosclrsesoi arteriolosclrseiso arteriolosclrseios arteriolosclrseois arteriolosclrseosi
arterioloscloresis arterioloscloressi arterioloscloreiss arterioloscloreiss arterioloscloresis arterioloscloressi
arteriolosclorseis arteriolosclorsesi arteriolosclorsies arteriolosclorsise arteriolosclorssie arteriolosclorssei
arteriolosclorises arteriolosclorisse arterioloscloriess arterioloscloriess arteriolosclorises arteriolosclorisse
arteriolosclorssie arteriolosclorssei arteriolosclorsise arteriolosclorsies arteriolosclorseis arteriolosclorsesi
arterioloscloersis arterioloscloerssi arterioloscloeriss arterioloscloeriss arterioloscloersis arterioloscloerssi
arterioloscloesris arterioloscloesrsi arterioloscloesirs arterioloscloesisr arterioloscloessir arterioloscloessri
arterioloscloeisrs arterioloscloeissr arterioloscloeirss arterioloscloeirss arterioloscloeisrs arterioloscloeissr
arterioloscloessir arterioloscloessri arterioloscloesisr arterioloscloesirs arterioloscloesris arterioloscloesrsi
arterioloscloseris arteriolosclosersi arterioloscloseirs arterioloscloseisr arteriolosclosesir arteriolosclosesri
arteriolosclosreis arteriolosclosresi arteriolosclosries arteriolosclosrise arteriolosclosrsie arteriolosclosrsei
arteriolosclosires arteriolosclosirse arteriolosclosiers arteriolosclosiesr arteriolosclosiser arteriolosclosisre
arteriolosclossrie arteriolosclossrei arteriolosclossire arteriolosclossier arteriolosclosseir arteriolosclosseri
arterioloscloiesrs arterioloscloiessr arterioloscloierss arterioloscloierss arterioloscloiesrs arterioloscloiessr
arterioloscloisers arterioloscloisesr arterioloscloisres arterioloscloisrse arterioloscloissre arterioloscloisser
arterioloscloirses arterioloscloirsse arterioloscloiress arterioloscloiress arterioloscloirses arterioloscloirsse
arterioloscloissre arterioloscloisser arterioloscloisrse arterioloscloisres arterioloscloisers arterioloscloisesr
arteriolosclosesir arteriolosclosesri arterioloscloseisr arterioloscloseirs arterioloscloseris arteriolosclosersi
arteriolosclosseir arteriolosclosseri arteriolosclossier arteriolosclossire arteriolosclossrie arteriolosclossrei
arteriolosclosiser arteriolosclosisre arteriolosclosiesr arteriolosclosiers arteriolosclosires arteriolosclosirse
arteriolosclosrsie arteriolosclosrsei arteriolosclosrise arteriolosclosries arteriolosclosreis arteriolosclosresi
arteriolosclsroeis arteriolosclsroesi arteriolosclsroies arteriolosclsroise arteriolosclsrosie arteriolosclsrosei
arteriolosclsreois arteriolosclsreosi arteriolosclsreios arteriolosclsreiso arteriolosclsresio arteriolosclsresoi
arteriolosclsrieos arteriolosclsrieso arteriolosclsrioes arteriolosclsriose arteriolosclsrisoe arteriolosclsriseo
arteriolosclsrseio arteriolosclsrseoi arteriolosclsrsieo arteriolosclsrsioe arteriolosclsrsoie arteriolosclsrsoei
arteriolosclsoreis arteriolosclsoresi arteriolosclsories arteriolosclsorise arteriolosclsorsie arteriolosclsorsei
arteriolosclsoeris arteriolosclsoersi arteriolosclsoeirs arteriolosclsoeisr arteriolosclsoesir arteriolosclsoesri
arteriolosclsoiers arteriolosclsoiesr arteriolosclsoires arteriolosclsoirse arteriolosclsoisre arteriolosclsoiser
arteriolosclsoseir arteriolosclsoseri arteriolosclsosier arteriolosclsosire arteriolosclsosrie arteriolosclsosrei
arteriolosclseoris arteriolosclseorsi arteriolosclseoirs arteriolosclseoisr arteriolosclseosir arteriolosclseosri
arteriolosclserois arteriolosclserosi arteriolosclserios arteriolosclseriso arteriolosclsersio arteriolosclsersoi
arteriolosclseiros arteriolosclseirso arteriolosclseiors arteriolosclseiosr arteriolosclseisor arteriolosclseisro
arteriolosclsesrio arteriolosclsesroi arteriolosclsesiro arteriolosclsesior arteriolosclsesoir arteriolosclsesori
arteriolosclsioers arteriolosclsioesr arteriolosclsiores arteriolosclsiorse arteriolosclsiosre arteriolosclsioser
arteriolosclsieors arteriolosclsieosr arteriolosclsieros arteriolosclsierso arteriolosclsiesro arteriolosclsiesor
arteriolosclsireos arteriolosclsireso arteriolosclsiroes arteriolosclsirose arteriolosclsirsoe arteriolosclsirseo
arteriolosclsisero arteriolosclsiseor arteriolosclsisreo arteriolosclsisroe arteriolosclsisore arteriolosclsisoer
arteriolosclssoeir arteriolosclssoeri arteriolosclssoier arteriolosclssoire arteriolosclssorie arteriolosclssorei
arteriolosclsseoir arteriolosclsseori arteriolosclsseior arteriolosclsseiro arteriolosclsserio arteriolosclsseroi
arteriolosclssieor arteriolosclssiero arteriolosclssioer arteriolosclssiore arteriolosclssiroe arteriolosclssireo
arteriolosclssreio arteriolosclssreoi arteriolosclssrieo arteriolosclssrioe arteriolosclssroie arteriolosclssroei
arterioloscliroses arteriolosclirosse arterioloscliroess arterioloscliroess arterioloscliroses arteriolosclirosse
arteriolosclirsoes arteriolosclirsose arteriolosclirseos arteriolosclirseso arteriolosclirsseo arteriolosclirssoe
arterioloscliresos arterioloscliresso arteriolosclireoss arteriolosclireoss arterioloscliresos arterioloscliresso
arteriolosclirsseo arteriolosclirssoe arteriolosclirseso arteriolosclirseos arteriolosclirsoes arteriolosclirsose
arterioloscliorses arterioloscliorsse arteriolosclioress arteriolosclioress arterioloscliorses arterioloscliorsse
arterioloscliosres arterioloscliosrse arterioloscliosers arterioloscliosesr arterioloscliosser arterioloscliossre
arteriolosclioesrs arteriolosclioessr arteriolosclioerss arteriolosclioerss arteriolosclioesrs arteriolosclioessr
arterioloscliosser arterioloscliossre arterioloscliosesr arterioloscliosers arterioloscliosres arterioloscliosrse
arteriolosclisores arteriolosclisorse arteriolosclisoers arteriolosclisoesr arteriolosclisoser arteriolosclisosre
arteriolosclisroes arteriolosclisrose arteriolosclisreos arteriolosclisreso arteriolosclisrseo arteriolosclisrsoe
arterioloscliseros arterioloscliserso arterioloscliseors arterioloscliseosr arteriolosclisesor arteriolosclisesro
arteriolosclissreo arteriolosclissroe arteriolosclissero arteriolosclisseor arteriolosclissoer arteriolosclissore
arteriolosclieosrs arteriolosclieossr arteriolosclieorss arteriolosclieorss arteriolosclieosrs arteriolosclieossr
arterioloscliesors arterioloscliesosr arterioloscliesros arterioloscliesrso arterioloscliessro arterioloscliessor
arterioloscliersos arterioloscliersso arteriolosclieross arteriolosclieross arterioloscliersos arterioloscliersso
arterioloscliessro arterioloscliessor arterioloscliesrso arterioloscliesros arterioloscliesors arterioloscliesosr
arteriolosclisoser arteriolosclisosre arteriolosclisoesr arteriolosclisoers arteriolosclisores arteriolosclisorse
arteriolosclissoer arteriolosclissore arteriolosclisseor arteriolosclissero arteriolosclissreo arteriolosclissroe
arteriolosclisesor arteriolosclisesro arterioloscliseosr arterioloscliseors arterioloscliseros arterioloscliserso
arteriolosclisrseo arteriolosclisrsoe arteriolosclisreso arteriolosclisreos arteriolosclisroes arteriolosclisrose
arteriolosclsrosie arteriolosclsrosei arteriolosclsroise arteriolosclsroies arteriolosclsroeis arteriolosclsroesi
arteriolosclsrsoie arteriolosclsrsoei arteriolosclsrsioe arteriolosclsrsieo arteriolosclsrseio arteriolosclsrseoi
arteriolosclsrisoe arteriolosclsriseo arteriolosclsriose arteriolosclsrioes arteriolosclsrieos arteriolosclsrieso
arteriolosclsresio arteriolosclsresoi arteriolosclsreiso arteriolosclsreios arteriolosclsreois arteriolosclsreosi
arteriolosclsorsie arteriolosclsorsei arteriolosclsorise arteriolosclsories arteriolosclsoreis arteriolosclsoresi
arteriolosclsosrie arteriolosclsosrei arteriolosclsosire arteriolosclsosier arteriolosclsoseir arteriolosclsoseri
arteriolosclsoisre arteriolosclsoiser arteriolosclsoirse arteriolosclsoires arteriolosclsoiers arteriolosclsoiesr
arteriolosclsoesir arteriolosclsoesri arteriolosclsoeisr arteriolosclsoeirs arteriolosclsoeris arteriolosclsoersi
arteriolosclssorie arteriolosclssorei arteriolosclssoire arteriolosclssoier arteriolosclssoeir arteriolosclssoeri
arteriolosclssroie arteriolosclssroei arteriolosclssrioe arteriolosclssrieo arteriolosclssreio arteriolosclssreoi
arteriolosclssiroe arteriolosclssireo arteriolosclssiore arteriolosclssioer arteriolosclssieor arteriolosclssiero
arteriolosclsserio arteriolosclsseroi arteriolosclsseiro arteriolosclsseior arteriolosclsseoir arteriolosclsseori
arteriolosclsiosre arteriolosclsioser arteriolosclsiorse arteriolosclsiores arteriolosclsioers arteriolosclsioesr
arteriolosclsisore arteriolosclsisoer arteriolosclsisroe arteriolosclsisreo arteriolosclsisero arteriolosclsiseor
arteriolosclsirsoe arteriolosclsirseo arteriolosclsirose arteriolosclsiroes arteriolosclsireos arteriolosclsireso
arteriolosclsiesro arteriolosclsiesor arteriolosclsierso arteriolosclsieros arteriolosclsieors arteriolosclsieosr
arteriolosclseosir arteriolosclseosri arteriolosclseoisr arteriolosclseoirs arteriolosclseoris arteriolosclseorsi
arteriolosclsesoir arteriolosclsesori arteriolosclsesior arteriolosclsesiro arteriolosclsesrio arteriolosclsesroi
arteriolosclseisor arteriolosclseisro arteriolosclseiosr arteriolosclseiors arteriolosclseiros arteriolosclseirso
arteriolosclsersio arteriolosclsersoi arteriolosclseriso arteriolosclserios arteriolosclserois arteriolosclserosi
arterioloscelrosis arterioloscelrossi arterioloscelroiss arterioloscelroiss arterioloscelrosis arterioloscelrossi
arterioloscelrsois arterioloscelrsosi arterioloscelrsios arterioloscelrsiso arterioloscelrssio arterioloscelrssoi
arterioloscelrisos arterioloscelrisso arterioloscelrioss arterioloscelrioss arterioloscelrisos arterioloscelrisso
arterioloscelrssio arterioloscelrssoi arterioloscelrsiso arterioloscelrsios arterioloscelrsois arterioloscelrsosi
arterioloscelorsis arterioloscelorssi arteriolosceloriss arteriolosceloriss arterioloscelorsis arterioloscelorssi
arterioloscelosris arterioloscelosrsi arterioloscelosirs arterioloscelosisr arterioloscelossir arterioloscelossri
arteriolosceloisrs arteriolosceloissr arteriolosceloirss arteriolosceloirss arteriolosceloisrs arteriolosceloissr
arterioloscelossir arterioloscelossri arterioloscelosisr arterioloscelosirs arterioloscelosris arterioloscelosrsi
arterioloscelsoris arterioloscelsorsi arterioloscelsoirs arterioloscelsoisr arterioloscelsosir arterioloscelsosri
arterioloscelsrois arterioloscelsrosi arterioloscelsrios arterioloscelsriso arterioloscelsrsio arterioloscelsrsoi
arterioloscelsiros arterioloscelsirso arterioloscelsiors arterioloscelsiosr arterioloscelsisor arterioloscelsisro
arterioloscelssrio arterioloscelssroi arterioloscelssiro arterioloscelssior arterioloscelssoir arterioloscelssori
arteriolosceliosrs arteriolosceliossr arteriolosceliorss arteriolosceliorss arteriolosceliosrs arteriolosceliossr
arterioloscelisors arterioloscelisosr arterioloscelisros arterioloscelisrso arterioloscelissro arterioloscelissor
arterioloscelirsos arterioloscelirsso arteriolosceliross arteriolosceliross arterioloscelirsos arterioloscelirsso
arterioloscelissro arterioloscelissor arterioloscelisrso arterioloscelisros arterioloscelisors arterioloscelisosr
arterioloscelsosir arterioloscelsosri arterioloscelsoisr arterioloscelsoirs arterioloscelsoris arterioloscelsorsi
arterioloscelssoir arterioloscelssori arterioloscelssior arterioloscelssiro arterioloscelssrio arterioloscelssroi
arterioloscelsisor arterioloscelsisro arterioloscelsiosr arterioloscelsiors arterioloscelsiros arterioloscelsirso
arterioloscelsrsio arterioloscelsrsoi arterioloscelsriso arterioloscelsrios arterioloscelsrois arterioloscelsrosi
arterioloscerlosis arterioloscerlossi arterioloscerloiss arterioloscerloiss arterioloscerlosis arterioloscerlossi
arterioloscerlsois arterioloscerlsosi arterioloscerlsios arterioloscerlsiso arterioloscerlssio arterioloscerlssoi
arterioloscerlisos arterioloscerlisso arterioloscerlioss arterioloscerlioss arterioloscerlisos arterioloscerlisso
arterioloscerlssio arterioloscerlssoi arterioloscerlsiso arterioloscerlsios arterioloscerlsois arterioloscerlsosi
arterioloscerolsis arterioloscerolssi arteriolosceroliss arteriolosceroliss arterioloscerolsis arterioloscerolssi
arteriolosceroslis arteriolosceroslsi arterioloscerosils arterioloscerosisl arterioloscerossil arterioloscerossli
arteriolosceroisls arteriolosceroissl arteriolosceroilss arteriolosceroilss arteriolosceroisls arteriolosceroissl
arterioloscerossil arterioloscerossli arterioloscerosisl arterioloscerosils arteriolosceroslis arteriolosceroslsi
arterioloscersolis arterioloscersolsi arterioloscersoils arterioloscersoisl arterioloscersosil arterioloscersosli
arterioloscerslois arterioloscerslosi arterioloscerslios arterioloscersliso arterioloscerslsio arterioloscerslsoi
arterioloscersilos arterioloscersilso arterioloscersiols arterioloscersiosl arterioloscersisol arterioloscersislo
arterioloscersslio arterioloscerssloi arterioloscerssilo arterioloscerssiol arterioloscerssoil arterioloscerssoli
arteriolosceriosls arteriolosceriossl arteriolosceriolss arteriolosceriolss arteriolosceriosls arteriolosceriossl
arterioloscerisols arterioloscerisosl arterioloscerislos arterioloscerislso arterioloscerisslo arterioloscerissol
arterioloscerilsos arterioloscerilsso arteriolosceriloss arteriolosceriloss arterioloscerilsos arterioloscerilsso
arterioloscerisslo arterioloscerissol arterioloscerislso arterioloscerislos arterioloscerisols arterioloscerisosl
arterioloscersosil arterioloscersosli arterioloscersoisl arterioloscersoils arterioloscersolis arterioloscersolsi
arterioloscerssoil arterioloscerssoli arterioloscerssiol arterioloscerssilo arterioloscersslio arterioloscerssloi
arterioloscersisol arterioloscersislo arterioloscersiosl arterioloscersiols arterioloscersilos arterioloscersilso
arterioloscerslsio arterioloscerslsoi arterioloscersliso arterioloscerslios arterioloscerslois arterioloscerslosi
arteriolosceorlsis arteriolosceorlssi arteriolosceorliss arteriolosceorliss arteriolosceorlsis arteriolosceorlssi
arteriolosceorslis arteriolosceorslsi arteriolosceorsils arteriolosceorsisl arteriolosceorssil arteriolosceorssli
arteriolosceorisls arteriolosceorissl arteriolosceorilss arteriolosceorilss arteriolosceorisls arteriolosceorissl
arteriolosceorssil arteriolosceorssli arteriolosceorsisl arteriolosceorsils arteriolosceorslis arteriolosceorslsi
arteriolosceolrsis arteriolosceolrssi arteriolosceolriss arteriolosceolriss arteriolosceolrsis arteriolosceolrssi
arteriolosceolsris arteriolosceolsrsi arteriolosceolsirs arteriolosceolsisr arteriolosceolssir arteriolosceolssri
arteriolosceolisrs arteriolosceolissr arteriolosceolirss arteriolosceolirss arteriolosceolisrs arteriolosceolissr
arteriolosceolssir arteriolosceolssri arteriolosceolsisr arteriolosceolsirs arteriolosceolsris arteriolosceolsrsi
arteriolosceoslris arteriolosceoslrsi arteriolosceoslirs arteriolosceoslisr arteriolosceoslsir arteriolosceoslsri
arteriolosceosrlis arteriolosceosrlsi arteriolosceosrils arteriolosceosrisl arteriolosceosrsil arteriolosceosrsli
arteriolosceosirls arteriolosceosirsl arteriolosceosilrs arteriolosceosilsr arteriolosceosislr arteriolosceosisrl
arteriolosceossril arteriolosceossrli arteriolosceossirl arteriolosceossilr arteriolosceosslir arteriolosceosslri
arteriolosceoilsrs arteriolosceoilssr arteriolosceoilrss arteriolosceoilrss arteriolosceoilsrs arteriolosceoilssr
arteriolosceoislrs arteriolosceoislsr arteriolosceoisrls arteriolosceoisrsl arteriolosceoissrl arteriolosceoisslr
arteriolosceoirsls arteriolosceoirssl arteriolosceoirlss arteriolosceoirlss arteriolosceoirsls arteriolosceoirssl
arteriolosceoissrl arteriolosceoisslr arteriolosceoisrsl arteriolosceoisrls arteriolosceoislrs arteriolosceoislsr
arteriolosceoslsir arteriolosceoslsri arteriolosceoslisr arteriolosceoslirs arteriolosceoslris arteriolosceoslrsi
arteriolosceosslir arteriolosceosslri arteriolosceossilr arteriolosceossirl arteriolosceossril arteriolosceossrli
arteriolosceosislr arteriolosceosisrl arteriolosceosilsr arteriolosceosilrs arteriolosceosirls arteriolosceosirsl
arteriolosceosrsil arteriolosceosrsli arteriolosceosrisl arteriolosceosrils arteriolosceosrlis arteriolosceosrlsi
arterioloscesrolis arterioloscesrolsi arterioloscesroils arterioloscesroisl arterioloscesrosil arterioloscesrosli
arterioloscesrlois arterioloscesrlosi arterioloscesrlios arterioloscesrliso arterioloscesrlsio arterioloscesrlsoi
arterioloscesrilos arterioloscesrilso arterioloscesriols arterioloscesriosl arterioloscesrisol arterioloscesrislo
arterioloscesrslio arterioloscesrsloi arterioloscesrsilo arterioloscesrsiol arterioloscesrsoil arterioloscesrsoli
arterioloscesorlis arterioloscesorlsi arterioloscesorils arterioloscesorisl arterioloscesorsil arterioloscesorsli
arterioloscesolris arterioloscesolrsi arterioloscesolirs arterioloscesolisr arterioloscesolsir arterioloscesolsri
arterioloscesoilrs arterioloscesoilsr arterioloscesoirls arterioloscesoirsl arterioloscesoisrl arterioloscesoislr
arterioloscesoslir arterioloscesoslri arterioloscesosilr arterioloscesosirl arterioloscesosril arterioloscesosrli
arterioloscesloris arteriolosceslorsi arterioloscesloirs arterioloscesloisr arteriolosceslosir arteriolosceslosri
arteriolosceslrois arteriolosceslrosi arteriolosceslrios arteriolosceslriso arteriolosceslrsio arteriolosceslrsoi
arterioloscesliros arteriolosceslirso arterioloscesliors arterioloscesliosr arteriolosceslisor arteriolosceslisro
arteriolosceslsrio arteriolosceslsroi arteriolosceslsiro arteriolosceslsior arteriolosceslsoir arteriolosceslsori
arterioloscesiolrs arterioloscesiolsr arterioloscesiorls arterioloscesiorsl arterioloscesiosrl arterioloscesioslr
arterioloscesilors arterioloscesilosr arterioloscesilros arterioloscesilrso arterioloscesilsro arterioloscesilsor
arterioloscesirlos arterioloscesirlso arterioloscesirols arterioloscesirosl arterioloscesirsol arterioloscesirslo
arterioloscesislro arterioloscesislor arterioloscesisrlo arterioloscesisrol arterioloscesisorl arterioloscesisolr
arterioloscessolir arterioloscessolri arterioloscessoilr arterioloscessoirl arterioloscessoril arterioloscessorli
arterioloscessloir arterioloscesslori arterioloscesslior arterioloscessliro arterioloscesslrio arterioloscesslroi
arterioloscessilor arterioloscessilro arterioloscessiolr arterioloscessiorl arterioloscessirol arterioloscessirlo
arterioloscessrlio arterioloscessrloi arterioloscessrilo arterioloscessriol arterioloscessroil arterioloscessroli
arteriolosceirosls arteriolosceirossl arteriolosceirolss arteriolosceirolss arteriolosceirosls arteriolosceirossl
arteriolosceirsols arteriolosceirsosl arteriolosceirslos arteriolosceirslso arteriolosceirsslo arteriolosceirssol
arteriolosceirlsos arteriolosceirlsso arteriolosceirloss arteriolosceirloss arteriolosceirlsos arteriolosceirlsso
arteriolosceirsslo arteriolosceirssol arteriolosceirslso arteriolosceirslos arteriolosceirsols arteriolosceirsosl
arteriolosceiorsls arteriolosceiorssl arteriolosceiorlss arteriolosceiorlss arteriolosceiorsls arteriolosceiorssl
arteriolosceiosrls arteriolosceiosrsl arteriolosceioslrs arteriolosceioslsr arteriolosceiosslr arteriolosceiossrl
arteriolosceiolsrs arteriolosceiolssr arteriolosceiolrss arteriolosceiolrss arteriolosceiolsrs arteriolosceiolssr
arteriolosceiosslr arteriolosceiossrl arteriolosceioslsr arteriolosceioslrs arteriolosceiosrls arteriolosceiosrsl
arteriolosceisorls arteriolosceisorsl arteriolosceisolrs arteriolosceisolsr arteriolosceisoslr arteriolosceisosrl
arteriolosceisrols arteriolosceisrosl arteriolosceisrlos arteriolosceisrlso arteriolosceisrslo arteriolosceisrsol
arteriolosceislros arteriolosceislrso arteriolosceislors arteriolosceislosr arteriolosceislsor arteriolosceislsro
arteriolosceissrlo arteriolosceissrol arteriolosceisslro arteriolosceisslor arteriolosceissolr arteriolosceissorl
arteriolosceilosrs arteriolosceilossr arteriolosceilorss arteriolosceilorss arteriolosceilosrs arteriolosceilossr
arteriolosceilsors arteriolosceilsosr arteriolosceilsros arteriolosceilsrso arteriolosceilssro arteriolosceilssor
arteriolosceilrsos arteriolosceilrsso arteriolosceilross arteriolosceilross arteriolosceilrsos arteriolosceilrsso
arteriolosceilssro arteriolosceilssor arteriolosceilsrso arteriolosceilsros arteriolosceilsors arteriolosceilsosr
arteriolosceisoslr arteriolosceisosrl arteriolosceisolsr arteriolosceisolrs arteriolosceisorls arteriolosceisorsl
arteriolosceissolr arteriolosceissorl arteriolosceisslor arteriolosceisslro arteriolosceissrlo arteriolosceissrol
arteriolosceislsor arteriolosceislsro arteriolosceislosr arteriolosceislors arteriolosceislros arteriolosceislrso
arteriolosceisrslo arteriolosceisrsol arteriolosceisrlso arteriolosceisrlos arteriolosceisrols arteriolosceisrosl
arterioloscesrosil arterioloscesrosli arterioloscesroisl arterioloscesroils arterioloscesrolis arterioloscesrolsi
arterioloscesrsoil arterioloscesrsoli arterioloscesrsiol arterioloscesrsilo arterioloscesrslio arterioloscesrsloi
arterioloscesrisol arterioloscesrislo arterioloscesriosl arterioloscesriols arterioloscesrilos arterioloscesrilso
arterioloscesrlsio arterioloscesrlsoi arterioloscesrliso arterioloscesrlios arterioloscesrlois arterioloscesrlosi
arterioloscesorsil arterioloscesorsli arterioloscesorisl arterioloscesorils arterioloscesorlis arterioloscesorlsi
arterioloscesosril arterioloscesosrli arterioloscesosirl arterioloscesosilr arterioloscesoslir arterioloscesoslri
arterioloscesoisrl arterioloscesoislr arterioloscesoirsl arterioloscesoirls arterioloscesoilrs arterioloscesoilsr
arterioloscesolsir arterioloscesolsri arterioloscesolisr arterioloscesolirs arterioloscesolris arterioloscesolrsi
arterioloscessoril arterioloscessorli arterioloscessoirl arterioloscessoilr arterioloscessolir arterioloscessolri
arterioloscessroil arterioloscessroli arterioloscessriol arterioloscessrilo arterioloscessrlio arterioloscessrloi
arterioloscessirol arterioloscessirlo arterioloscessiorl arterioloscessiolr arterioloscessilor arterioloscessilro
arterioloscesslrio arterioloscesslroi arterioloscessliro arterioloscesslior arterioloscessloir arterioloscesslori
arterioloscesiosrl arterioloscesioslr arterioloscesiorsl arterioloscesiorls arterioloscesiolrs arterioloscesiolsr
arterioloscesisorl arterioloscesisolr arterioloscesisrol arterioloscesisrlo arterioloscesislro arterioloscesislor
arterioloscesirsol arterioloscesirslo arterioloscesirosl arterioloscesirols arterioloscesirlos arterioloscesirlso
arterioloscesilsro arterioloscesilsor arterioloscesilrso arterioloscesilros arterioloscesilors arterioloscesilosr
arteriolosceslosir arteriolosceslosri arterioloscesloisr arterioloscesloirs arterioloscesloris arteriolosceslorsi
arteriolosceslsoir arteriolosceslsori arteriolosceslsior arteriolosceslsiro arteriolosceslsrio arteriolosceslsroi
arteriolosceslisor arteriolosceslisro arterioloscesliosr arterioloscesliors arterioloscesliros arteriolosceslirso
arteriolosceslrsio arteriolosceslrsoi arteriolosceslriso arteriolosceslrios arteriolosceslrois arteriolosceslrosi
arterioloscrelosis arterioloscrelossi arterioloscreloiss arterioloscreloiss arterioloscrelosis arterioloscrelossi
arterioloscrelsois arterioloscrelsosi arterioloscrelsios arterioloscrelsiso arterioloscrelssio arterioloscrelssoi
arterioloscrelisos arterioloscrelisso arterioloscrelioss arterioloscrelioss arterioloscrelisos arterioloscrelisso
arterioloscrelssio arterioloscrelssoi arterioloscrelsiso arterioloscrelsios arterioloscrelsois arterioloscrelsosi
arterioloscreolsis arterioloscreolssi arterioloscreoliss arterioloscreoliss arterioloscreolsis arterioloscreolssi
arterioloscreoslis arterioloscreoslsi arterioloscreosils arterioloscreosisl arterioloscreossil arterioloscreossli
arterioloscreoisls arterioloscreoissl arterioloscreoilss arterioloscreoilss arterioloscreoisls arterioloscreoissl
arterioloscreossil arterioloscreossli arterioloscreosisl arterioloscreosils arterioloscreoslis arterioloscreoslsi
arterioloscresolis arterioloscresolsi arterioloscresoils arterioloscresoisl arterioloscresosil arterioloscresosli
arterioloscreslois arterioloscreslosi arterioloscreslios arterioloscresliso arterioloscreslsio arterioloscreslsoi
arterioloscresilos arterioloscresilso arterioloscresiols arterioloscresiosl arterioloscresisol arterioloscresislo
arterioloscresslio arterioloscressloi arterioloscressilo arterioloscressiol arterioloscressoil arterioloscressoli
arterioloscreiosls arterioloscreiossl arterioloscreiolss arterioloscreiolss arterioloscreiosls arterioloscreiossl
arterioloscreisols arterioloscreisosl arterioloscreislos arterioloscreislso arterioloscreisslo arterioloscreissol
arterioloscreilsos arterioloscreilsso arterioloscreiloss arterioloscreiloss arterioloscreilsos arterioloscreilsso
arterioloscreisslo arterioloscreissol arterioloscreislso arterioloscreislos arterioloscreisols arterioloscreisosl
arterioloscresosil arterioloscresosli arterioloscresoisl arterioloscresoils arterioloscresolis arterioloscresolsi
arterioloscressoil arterioloscressoli arterioloscressiol arterioloscressilo arterioloscresslio arterioloscressloi
arterioloscresisol arterioloscresislo arterioloscresiosl arterioloscresiols arterioloscresilos arterioloscresilso
arterioloscreslsio arterioloscreslsoi arterioloscresliso arterioloscreslios arterioloscreslois arterioloscreslosi
arterioloscrleosis arterioloscrleossi arterioloscrleoiss arterioloscrleoiss arterioloscrleosis arterioloscrleossi
arterioloscrlesois arterioloscrlesosi arterioloscrlesios arterioloscrlesiso arterioloscrlessio arterioloscrlessoi
arterioloscrleisos arterioloscrleisso arterioloscrleioss arterioloscrleioss arterioloscrleisos arterioloscrleisso
arterioloscrlessio arterioloscrlessoi arterioloscrlesiso arterioloscrlesios arterioloscrlesois arterioloscrlesosi
arterioloscrloesis arterioloscrloessi arterioloscrloeiss arterioloscrloeiss arterioloscrloesis arterioloscrloessi
arterioloscrloseis arterioloscrlosesi arterioloscrlosies arterioloscrlosise arterioloscrlossie arterioloscrlossei
arterioloscrloises arterioloscrloisse arterioloscrloiess arterioloscrloiess arterioloscrloises arterioloscrloisse
arterioloscrlossie arterioloscrlossei arterioloscrlosise arterioloscrlosies arterioloscrloseis arterioloscrlosesi
arterioloscrlsoeis arterioloscrlsoesi arterioloscrlsoies arterioloscrlsoise arterioloscrlsosie arterioloscrlsosei
arterioloscrlseois arterioloscrlseosi arterioloscrlseios arterioloscrlseiso arterioloscrlsesio arterioloscrlsesoi
arterioloscrlsieos arterioloscrlsieso arterioloscrlsioes arterioloscrlsiose arterioloscrlsisoe arterioloscrlsiseo
arterioloscrlsseio arterioloscrlsseoi arterioloscrlssieo arterioloscrlssioe arterioloscrlssoie arterioloscrlssoei
arterioloscrlioses arterioloscrliosse arterioloscrlioess arterioloscrlioess arterioloscrlioses arterioloscrliosse
arterioloscrlisoes arterioloscrlisose arterioloscrliseos arterioloscrliseso arterioloscrlisseo arterioloscrlissoe
arterioloscrliesos arterioloscrliesso arterioloscrlieoss arterioloscrlieoss arterioloscrliesos arterioloscrliesso
arterioloscrlisseo arterioloscrlissoe arterioloscrliseso arterioloscrliseos arterioloscrlisoes arterioloscrlisose
arterioloscrlsosie arterioloscrlsosei arterioloscrlsoise arterioloscrlsoies arterioloscrlsoeis arterioloscrlsoesi
arterioloscrlssoie arterioloscrlssoei arterioloscrlssioe arterioloscrlssieo arterioloscrlsseio arterioloscrlsseoi
arterioloscrlsisoe arterioloscrlsiseo arterioloscrlsiose arterioloscrlsioes arterioloscrlsieos arterioloscrlsieso
arterioloscrlsesio arterioloscrlsesoi arterioloscrlseiso arterioloscrlseios arterioloscrlseois arterioloscrlseosi
arterioloscrolesis arterioloscrolessi arterioloscroleiss arterioloscroleiss arterioloscrolesis arterioloscrolessi
arterioloscrolseis arterioloscrolsesi arterioloscrolsies arterioloscrolsise arterioloscrolssie arterioloscrolssei
arterioloscrolises arterioloscrolisse arterioloscroliess arterioloscroliess arterioloscrolises arterioloscrolisse
arterioloscrolssie arterioloscrolssei arterioloscrolsise arterioloscrolsies arterioloscrolseis arterioloscrolsesi
arterioloscroelsis arterioloscroelssi arterioloscroeliss arterioloscroeliss arterioloscroelsis arterioloscroelssi
arterioloscroeslis arterioloscroeslsi arterioloscroesils arterioloscroesisl arterioloscroessil arterioloscroessli
arterioloscroeisls arterioloscroeissl arterioloscroeilss arterioloscroeilss arterioloscroeisls arterioloscroeissl
arterioloscroessil arterioloscroessli arterioloscroesisl arterioloscroesils arterioloscroeslis arterioloscroeslsi
arterioloscroselis arterioloscroselsi arterioloscroseils arterioloscroseisl arterioloscrosesil arterioloscrosesli
arterioloscrosleis arterioloscroslesi arterioloscroslies arterioloscroslise arterioloscroslsie arterioloscroslsei
arterioloscrosiles arterioloscrosilse arterioloscrosiels arterioloscrosiesl arterioloscrosisel arterioloscrosisle
arterioloscrosslie arterioloscrosslei arterioloscrossile arterioloscrossiel arterioloscrosseil arterioloscrosseli
arterioloscroiesls arterioloscroiessl arterioloscroielss arterioloscroielss arterioloscroiesls arterioloscroiessl
arterioloscroisels arterioloscroisesl arterioloscroisles arterioloscroislse arterioloscroissle arterioloscroissel
arterioloscroilses arterioloscroilsse arterioloscroiless arterioloscroiless arterioloscroilses arterioloscroilsse
arterioloscroissle arterioloscroissel arterioloscroislse arterioloscroisles arterioloscroisels arterioloscroisesl
arterioloscrosesil arterioloscrosesli arterioloscroseisl arterioloscroseils arterioloscroselis arterioloscroselsi
arterioloscrosseil arterioloscrosseli arterioloscrossiel arterioloscrossile arterioloscrosslie arterioloscrosslei
arterioloscrosisel arterioloscrosisle arterioloscrosiesl arterioloscrosiels arterioloscrosiles arterioloscrosilse
arterioloscroslsie arterioloscroslsei arterioloscroslise arterioloscroslies arterioloscrosleis arterioloscroslesi
arterioloscrsloeis arterioloscrsloesi arterioloscrsloies arterioloscrsloise arterioloscrslosie arterioloscrslosei
arterioloscrsleois arterioloscrsleosi arterioloscrsleios arterioloscrsleiso arterioloscrslesio arterioloscrslesoi
arterioloscrslieos arterioloscrslieso arterioloscrslioes arterioloscrsliose arterioloscrslisoe arterioloscrsliseo
arterioloscrslseio arterioloscrslseoi arterioloscrslsieo arterioloscrslsioe arterioloscrslsoie arterioloscrslsoei
arterioloscrsoleis arterioloscrsolesi arterioloscrsolies arterioloscrsolise arterioloscrsolsie arterioloscrsolsei
arterioloscrsoelis arterioloscrsoelsi arterioloscrsoeils arterioloscrsoeisl arterioloscrsoesil arterioloscrsoesli
arterioloscrsoiels arterioloscrsoiesl arterioloscrsoiles arterioloscrsoilse arterioloscrsoisle arterioloscrsoisel
arterioloscrsoseil arterioloscrsoseli arterioloscrsosiel arterioloscrsosile arterioloscrsoslie arterioloscrsoslei
arterioloscrseolis arterioloscrseolsi arterioloscrseoils arterioloscrseoisl arterioloscrseosil arterioloscrseosli
arterioloscrselois arterioloscrselosi arterioloscrselios arterioloscrseliso arterioloscrselsio arterioloscrselsoi
arterioloscrseilos arterioloscrseilso arterioloscrseiols arterioloscrseiosl arterioloscrseisol arterioloscrseislo
arterioloscrseslio arterioloscrsesloi arterioloscrsesilo arterioloscrsesiol arterioloscrsesoil arterioloscrsesoli
arterioloscrsioels arterioloscrsioesl arterioloscrsioles arterioloscrsiolse arterioloscrsiosle arterioloscrsiosel
arterioloscrsieols arterioloscrsieosl arterioloscrsielos arterioloscrsielso arterioloscrsieslo arterioloscrsiesol
arterioloscrsileos arterioloscrsileso arterioloscrsiloes arterioloscrsilose arterioloscrsilsoe arterioloscrsilseo
arterioloscrsiselo arterioloscrsiseol arterioloscrsisleo arterioloscrsisloe arterioloscrsisole arterioloscrsisoel
arterioloscrssoeil arterioloscrssoeli arterioloscrssoiel arterioloscrssoile arterioloscrssolie arterioloscrssolei
arterioloscrsseoil arterioloscrsseoli arterioloscrsseiol arterioloscrsseilo arterioloscrsselio arterioloscrsseloi
arterioloscrssieol arterioloscrssielo arterioloscrssioel arterioloscrssiole arterioloscrssiloe arterioloscrssileo
arterioloscrssleio arterioloscrssleoi arterioloscrsslieo arterioloscrsslioe arterioloscrssloie arterioloscrssloei
arterioloscriloses arterioloscrilosse arterioloscriloess arterioloscriloess arterioloscriloses arterioloscrilosse
arterioloscrilsoes arterioloscrilsose arterioloscrilseos arterioloscrilseso arterioloscrilsseo arterioloscrilssoe
arterioloscrilesos arterioloscrilesso arterioloscrileoss arterioloscrileoss arterioloscrilesos arterioloscrilesso
arterioloscrilsseo arterioloscrilssoe arterioloscrilseso arterioloscrilseos arterioloscrilsoes arterioloscrilsose
arterioloscriolses arterioloscriolsse arterioloscrioless arterioloscrioless arterioloscriolses arterioloscriolsse
arterioloscriosles arterioloscrioslse arterioloscriosels arterioloscriosesl arterioloscriossel arterioloscriossle
arterioloscrioesls arterioloscrioessl arterioloscrioelss arterioloscrioelss arterioloscrioesls arterioloscrioessl
arterioloscriossel arterioloscriossle arterioloscriosesl arterioloscriosels arterioloscriosles arterioloscrioslse
arterioloscrisoles arterioloscrisolse arterioloscrisoels arterioloscrisoesl arterioloscrisosel arterioloscrisosle
arterioloscrisloes arterioloscrislose arterioloscrisleos arterioloscrisleso arterioloscrislseo arterioloscrislsoe
arterioloscriselos arterioloscriselso arterioloscriseols arterioloscriseosl arterioloscrisesol arterioloscriseslo
arterioloscrissleo arterioloscrissloe arterioloscrisselo arterioloscrisseol arterioloscrissoel arterioloscrissole
arterioloscrieosls arterioloscrieossl arterioloscrieolss arterioloscrieolss arterioloscrieosls arterioloscrieossl
arterioloscriesols arterioloscriesosl arterioloscrieslos arterioloscrieslso arterioloscriesslo arterioloscriessol
arterioloscrielsos arterioloscrielsso arterioloscrieloss arterioloscrieloss arterioloscrielsos arterioloscrielsso
arterioloscriesslo arterioloscriessol arterioloscrieslso arterioloscrieslos arterioloscriesols arterioloscriesosl
arterioloscrisosel arterioloscrisosle arterioloscrisoesl arterioloscrisoels arterioloscrisoles arterioloscrisolse
arterioloscrissoel arterioloscrissole arterioloscrisseol arterioloscrisselo arterioloscrissleo arterioloscrissloe
arterioloscrisesol arterioloscriseslo arterioloscriseosl arterioloscriseols arterioloscriselos arterioloscriselso
arterioloscrislseo arterioloscrislsoe arterioloscrisleso arterioloscrisleos arterioloscrisloes arterioloscrislose
arterioloscrslosie arterioloscrslosei arterioloscrsloise arterioloscrsloies arterioloscrsloeis arterioloscrsloesi
arterioloscrslsoie arterioloscrslsoei arterioloscrslsioe arterioloscrslsieo arterioloscrslseio arterioloscrslseoi
arterioloscrslisoe arterioloscrsliseo arterioloscrsliose arterioloscrslioes arterioloscrslieos arterioloscrslieso
arterioloscrslesio arterioloscrslesoi arterioloscrsleiso arterioloscrsleios arterioloscrsleois arterioloscrsleosi
arterioloscrsolsie arterioloscrsolsei arterioloscrsolise arterioloscrsolies arterioloscrsoleis arterioloscrsolesi
arterioloscrsoslie arterioloscrsoslei arterioloscrsosile arterioloscrsosiel arterioloscrsoseil arterioloscrsoseli
arterioloscrsoisle arterioloscrsoisel arterioloscrsoilse arterioloscrsoiles arterioloscrsoiels arterioloscrsoiesl
arterioloscrsoesil arterioloscrsoesli arterioloscrsoeisl arterioloscrsoeils arterioloscrsoelis arterioloscrsoelsi
arterioloscrssolie arterioloscrssolei arterioloscrssoile arterioloscrssoiel arterioloscrssoeil arterioloscrssoeli
arterioloscrssloie arterioloscrssloei arterioloscrsslioe arterioloscrsslieo arterioloscrssleio arterioloscrssleoi
arterioloscrssiloe arterioloscrssileo arterioloscrssiole arterioloscrssioel arterioloscrssieol arterioloscrssielo
arterioloscrsselio arterioloscrsseloi arterioloscrsseilo arterioloscrsseiol arterioloscrsseoil arterioloscrsseoli
arterioloscrsiosle arterioloscrsiosel arterioloscrsiolse arterioloscrsioles arterioloscrsioels arterioloscrsioesl
arterioloscrsisole arterioloscrsisoel arterioloscrsisloe arterioloscrsisleo arterioloscrsiselo arterioloscrsiseol
arterioloscrsilsoe arterioloscrsilseo arterioloscrsilose arterioloscrsiloes arterioloscrsileos arterioloscrsileso
arterioloscrsieslo arterioloscrsiesol arterioloscrsielso arterioloscrsielos arterioloscrsieols arterioloscrsieosl
arterioloscrseosil arterioloscrseosli arterioloscrseoisl arterioloscrseoils arterioloscrseolis arterioloscrseolsi
arterioloscrsesoil arterioloscrsesoli arterioloscrsesiol arterioloscrsesilo arterioloscrseslio arterioloscrsesloi
arterioloscrseisol arterioloscrseislo arterioloscrseiosl arterioloscrseiols arterioloscrseilos arterioloscrseilso
arterioloscrselsio arterioloscrselsoi arterioloscrseliso arterioloscrselios arterioloscrselois arterioloscrselosi
arterioloscoerlsis arterioloscoerlssi arterioloscoerliss arterioloscoerliss arterioloscoerlsis arterioloscoerlssi
arterioloscoerslis arterioloscoerslsi arterioloscoersils arterioloscoersisl arterioloscoerssil arterioloscoerssli
arterioloscoerisls arterioloscoerissl arterioloscoerilss arterioloscoerilss arterioloscoerisls arterioloscoerissl
arterioloscoerssil arterioloscoerssli arterioloscoersisl arterioloscoersils arterioloscoerslis arterioloscoerslsi
arterioloscoelrsis arterioloscoelrssi arterioloscoelriss arterioloscoelriss arterioloscoelrsis arterioloscoelrssi
arterioloscoelsris arterioloscoelsrsi arterioloscoelsirs arterioloscoelsisr arterioloscoelssir arterioloscoelssri
arterioloscoelisrs arterioloscoelissr arterioloscoelirss arterioloscoelirss arterioloscoelisrs arterioloscoelissr
arterioloscoelssir arterioloscoelssri arterioloscoelsisr arterioloscoelsirs arterioloscoelsris arterioloscoelsrsi
arterioloscoeslris arterioloscoeslrsi arterioloscoeslirs arterioloscoeslisr arterioloscoeslsir arterioloscoeslsri
arterioloscoesrlis arterioloscoesrlsi arterioloscoesrils arterioloscoesrisl arterioloscoesrsil arterioloscoesrsli
arterioloscoesirls arterioloscoesirsl arterioloscoesilrs arterioloscoesilsr arterioloscoesislr arterioloscoesisrl
arterioloscoessril arterioloscoessrli arterioloscoessirl arterioloscoessilr arterioloscoesslir arterioloscoesslri
arterioloscoeilsrs arterioloscoeilssr arterioloscoeilrss arterioloscoeilrss arterioloscoeilsrs arterioloscoeilssr
arterioloscoeislrs arterioloscoeislsr arterioloscoeisrls arterioloscoeisrsl arterioloscoeissrl arterioloscoeisslr
arterioloscoeirsls arterioloscoeirssl arterioloscoeirlss arterioloscoeirlss arterioloscoeirsls arterioloscoeirssl
arterioloscoeissrl arterioloscoeisslr arterioloscoeisrsl arterioloscoeisrls arterioloscoeislrs arterioloscoeislsr
arterioloscoeslsir arterioloscoeslsri arterioloscoeslisr arterioloscoeslirs arterioloscoeslris arterioloscoeslrsi
arterioloscoesslir arterioloscoesslri arterioloscoessilr arterioloscoessirl arterioloscoessril arterioloscoessrli
arterioloscoesislr arterioloscoesisrl arterioloscoesilsr arterioloscoesilrs arterioloscoesirls arterioloscoesirsl
arterioloscoesrsil arterioloscoesrsli arterioloscoesrisl arterioloscoesrils arterioloscoesrlis arterioloscoesrlsi
arterioloscorelsis arterioloscorelssi arterioloscoreliss arterioloscoreliss arterioloscorelsis arterioloscorelssi
arterioloscoreslis arterioloscoreslsi arterioloscoresils arterioloscoresisl arterioloscoressil arterioloscoressli
arterioloscoreisls arterioloscoreissl arterioloscoreilss arterioloscoreilss arterioloscoreisls arterioloscoreissl
arterioloscoressil arterioloscoressli arterioloscoresisl arterioloscoresils arterioloscoreslis arterioloscoreslsi
arterioloscorlesis arterioloscorlessi arterioloscorleiss arterioloscorleiss arterioloscorlesis arterioloscorlessi
arterioloscorlseis arterioloscorlsesi arterioloscorlsies arterioloscorlsise arterioloscorlssie arterioloscorlssei
arterioloscorlises arterioloscorlisse arterioloscorliess arterioloscorliess arterioloscorlises arterioloscorlisse
arterioloscorlssie arterioloscorlssei arterioloscorlsise arterioloscorlsies arterioloscorlseis arterioloscorlsesi
arterioloscorsleis arterioloscorslesi arterioloscorslies arterioloscorslise arterioloscorslsie arterioloscorslsei
arterioloscorselis arterioloscorselsi arterioloscorseils arterioloscorseisl arterioloscorsesil arterioloscorsesli
arterioloscorsiels arterioloscorsiesl arterioloscorsiles arterioloscorsilse arterioloscorsisle arterioloscorsisel
arterioloscorsseil arterioloscorsseli arterioloscorssiel arterioloscorssile arterioloscorsslie arterioloscorsslei
arterioloscorilses arterioloscorilsse arterioloscoriless arterioloscoriless arterioloscorilses arterioloscorilsse
arterioloscorisles arterioloscorislse arterioloscorisels arterioloscorisesl arterioloscorissel arterioloscorissle
arterioloscoriesls arterioloscoriessl arterioloscorielss arterioloscorielss arterioloscoriesls arterioloscoriessl
arterioloscorissel arterioloscorissle arterioloscorisesl arterioloscorisels arterioloscorisles arterioloscorislse
arterioloscorslsie arterioloscorslsei arterioloscorslise arterioloscorslies arterioloscorsleis arterioloscorslesi
arterioloscorsslie arterioloscorsslei arterioloscorssile arterioloscorssiel arterioloscorsseil arterioloscorsseli
arterioloscorsisle arterioloscorsisel arterioloscorsilse arterioloscorsiles arterioloscorsiels arterioloscorsiesl
arterioloscorsesil arterioloscorsesli arterioloscorseisl arterioloscorseils arterioloscorselis arterioloscorselsi
arterioloscolresis arterioloscolressi arterioloscolreiss arterioloscolreiss arterioloscolresis arterioloscolressi
arterioloscolrseis arterioloscolrsesi arterioloscolrsies arterioloscolrsise arterioloscolrssie arterioloscolrssei
arterioloscolrises arterioloscolrisse arterioloscolriess arterioloscolriess arterioloscolrises arterioloscolrisse
arterioloscolrssie arterioloscolrssei arterioloscolrsise arterioloscolrsies arterioloscolrseis arterioloscolrsesi
arterioloscolersis arterioloscolerssi arterioloscoleriss arterioloscoleriss arterioloscolersis arterioloscolerssi
arterioloscolesris arterioloscolesrsi arterioloscolesirs arterioloscolesisr arterioloscolessir arterioloscolessri
arterioloscoleisrs arterioloscoleissr arterioloscoleirss arterioloscoleirss arterioloscoleisrs arterioloscoleissr
arterioloscolessir arterioloscolessri arterioloscolesisr arterioloscolesirs arterioloscolesris arterioloscolesrsi
arterioloscolseris arterioloscolsersi arterioloscolseirs arterioloscolseisr arterioloscolsesir arterioloscolsesri
arterioloscolsreis arterioloscolsresi arterioloscolsries arterioloscolsrise arterioloscolsrsie arterioloscolsrsei
arterioloscolsires arterioloscolsirse arterioloscolsiers arterioloscolsiesr arterioloscolsiser arterioloscolsisre
arterioloscolssrie arterioloscolssrei arterioloscolssire arterioloscolssier arterioloscolsseir arterioloscolsseri
arterioloscoliesrs arterioloscoliessr arterioloscolierss arterioloscolierss arterioloscoliesrs arterioloscoliessr
arterioloscolisers arterioloscolisesr arterioloscolisres arterioloscolisrse arterioloscolissre arterioloscolisser
arterioloscolirses arterioloscolirsse arterioloscoliress arterioloscoliress arterioloscolirses arterioloscolirsse
arterioloscolissre arterioloscolisser arterioloscolisrse arterioloscolisres arterioloscolisers arterioloscolisesr
arterioloscolsesir arterioloscolsesri arterioloscolseisr arterioloscolseirs arterioloscolseris arterioloscolsersi
arterioloscolsseir arterioloscolsseri arterioloscolssier arterioloscolssire arterioloscolssrie arterioloscolssrei
arterioloscolsiser arterioloscolsisre arterioloscolsiesr arterioloscolsiers arterioloscolsires arterioloscolsirse
arterioloscolsrsie arterioloscolsrsei arterioloscolsrise arterioloscolsries arterioloscolsreis arterioloscolsresi
arterioloscosrleis arterioloscosrlesi arterioloscosrlies arterioloscosrlise arterioloscosrlsie arterioloscosrlsei
arterioloscosrelis arterioloscosrelsi arterioloscosreils arterioloscosreisl arterioloscosresil arterioloscosresli
arterioloscosriels arterioloscosriesl arterioloscosriles arterioloscosrilse arterioloscosrisle arterioloscosrisel
arterioloscosrseil arterioloscosrseli arterioloscosrsiel arterioloscosrsile arterioloscosrslie arterioloscosrslei
arterioloscoslreis arterioloscoslresi arterioloscoslries arterioloscoslrise arterioloscoslrsie arterioloscoslrsei
arterioloscosleris arterioloscoslersi arterioloscosleirs arterioloscosleisr arterioloscoslesir arterioloscoslesri
arterioloscosliers arterioloscosliesr arterioloscoslires arterioloscoslirse arterioloscoslisre arterioloscosliser
arterioloscoslseir arterioloscoslseri arterioloscoslsier arterioloscoslsire arterioloscoslsrie arterioloscoslsrei
arterioloscoselris arterioloscoselrsi arterioloscoselirs arterioloscoselisr arterioloscoselsir arterioloscoselsri
arterioloscoserlis arterioloscoserlsi arterioloscoserils arterioloscoserisl arterioloscosersil arterioloscosersli
arterioloscoseirls arterioloscoseirsl arterioloscoseilrs arterioloscoseilsr arterioloscoseislr arterioloscoseisrl
arterioloscosesril arterioloscosesrli arterioloscosesirl arterioloscosesilr arterioloscoseslir arterioloscoseslri
arterioloscosilers arterioloscosilesr arterioloscosilres arterioloscosilrse arterioloscosilsre arterioloscosilser
arterioloscosielrs arterioloscosielsr arterioloscosierls arterioloscosiersl arterioloscosiesrl arterioloscosieslr
arterioloscosirels arterioloscosiresl arterioloscosirles arterioloscosirlse arterioloscosirsle arterioloscosirsel
arterioloscosiserl arterioloscosiselr arterioloscosisrel arterioloscosisrle arterioloscosislre arterioloscosisler
arterioloscossleir arterioloscossleri arterioloscosslier arterioloscosslire arterioloscosslrie arterioloscosslrei
arterioloscosselir arterioloscosselri arterioloscosseilr arterioloscosseirl arterioloscosseril arterioloscosserli
arterioloscossielr arterioloscossierl arterioloscossiler arterioloscossilre arterioloscossirle arterioloscossirel
arterioloscossreil arterioloscossreli arterioloscossriel arterioloscossrile arterioloscossrlie arterioloscossrlei
arterioloscoirlses arterioloscoirlsse arterioloscoirless arterioloscoirless arterioloscoirlses arterioloscoirlsse
arterioloscoirsles arterioloscoirslse arterioloscoirsels arterioloscoirsesl arterioloscoirssel arterioloscoirssle
arterioloscoiresls arterioloscoiressl arterioloscoirelss arterioloscoirelss arterioloscoiresls arterioloscoiressl
arterioloscoirssel arterioloscoirssle arterioloscoirsesl arterioloscoirsels arterioloscoirsles arterioloscoirslse
arterioloscoilrses arterioloscoilrsse arterioloscoilress arterioloscoilress arterioloscoilrses arterioloscoilrsse
arterioloscoilsres arterioloscoilsrse arterioloscoilsers arterioloscoilsesr arterioloscoilsser arterioloscoilssre
arterioloscoilesrs arterioloscoilessr arterioloscoilerss arterioloscoilerss arterioloscoilesrs arterioloscoilessr
arterioloscoilsser arterioloscoilssre arterioloscoilsesr arterioloscoilsers arterioloscoilsres arterioloscoilsrse
arterioloscoislres arterioloscoislrse arterioloscoislers arterioloscoislesr arterioloscoislser arterioloscoislsre
arterioloscoisrles arterioloscoisrlse arterioloscoisrels arterioloscoisresl arterioloscoisrsel arterioloscoisrsle
arterioloscoiserls arterioloscoisersl arterioloscoiselrs arterioloscoiselsr arterioloscoiseslr arterioloscoisesrl
arterioloscoissrel arterioloscoissrle arterioloscoisserl arterioloscoisselr arterioloscoissler arterioloscoisslre
arterioloscoielsrs arterioloscoielssr arterioloscoielrss arterioloscoielrss arterioloscoielsrs arterioloscoielssr
arterioloscoieslrs arterioloscoieslsr arterioloscoiesrls arterioloscoiesrsl arterioloscoiessrl arterioloscoiesslr
arterioloscoiersls arterioloscoierssl arterioloscoierlss arterioloscoierlss arterioloscoiersls arterioloscoierssl
arterioloscoiessrl arterioloscoiesslr arterioloscoiesrsl arterioloscoiesrls arterioloscoieslrs arterioloscoieslsr
arterioloscoislser arterioloscoislsre arterioloscoislesr arterioloscoislers arterioloscoislres arterioloscoislrse
arterioloscoissler arterioloscoisslre arterioloscoisselr arterioloscoisserl arterioloscoissrel arterioloscoissrle
arterioloscoiseslr arterioloscoisesrl arterioloscoiselsr arterioloscoiselrs arterioloscoiserls arterioloscoisersl
arterioloscoisrsel arterioloscoisrsle arterioloscoisresl arterioloscoisrels arterioloscoisrles arterioloscoisrlse
arterioloscosrlsie arterioloscosrlsei arterioloscosrlise arterioloscosrlies arterioloscosrleis arterioloscosrlesi
arterioloscosrslie arterioloscosrslei arterioloscosrsile arterioloscosrsiel arterioloscosrseil arterioloscosrseli
arterioloscosrisle arterioloscosrisel arterioloscosrilse arterioloscosriles arterioloscosriels arterioloscosriesl
arterioloscosresil arterioloscosresli arterioloscosreisl arterioloscosreils arterioloscosrelis arterioloscosrelsi
arterioloscoslrsie arterioloscoslrsei arterioloscoslrise arterioloscoslries arterioloscoslreis arterioloscoslresi
arterioloscoslsrie arterioloscoslsrei arterioloscoslsire arterioloscoslsier arterioloscoslseir arterioloscoslseri
arterioloscoslisre arterioloscosliser arterioloscoslirse arterioloscoslires arterioloscosliers arterioloscosliesr
arterioloscoslesir arterioloscoslesri arterioloscosleisr arterioloscosleirs arterioloscosleris arterioloscoslersi
arterioloscosslrie arterioloscosslrei arterioloscosslire arterioloscosslier arterioloscossleir arterioloscossleri
arterioloscossrlie arterioloscossrlei arterioloscossrile arterioloscossriel arterioloscossreil arterioloscossreli
arterioloscossirle arterioloscossirel arterioloscossilre arterioloscossiler arterioloscossielr arterioloscossierl
arterioloscosseril arterioloscosserli arterioloscosseirl arterioloscosseilr arterioloscosselir arterioloscosselri
arterioloscosilsre arterioloscosilser arterioloscosilrse arterioloscosilres arterioloscosilers arterioloscosilesr
arterioloscosislre arterioloscosisler arterioloscosisrle arterioloscosisrel arterioloscosiserl arterioloscosiselr
arterioloscosirsle arterioloscosirsel arterioloscosirlse arterioloscosirles arterioloscosirels arterioloscosiresl
arterioloscosiesrl arterioloscosieslr arterioloscosiersl arterioloscosierls arterioloscosielrs arterioloscosielsr
arterioloscoselsir arterioloscoselsri arterioloscoselisr arterioloscoselirs arterioloscoselris arterioloscoselrsi
arterioloscoseslir arterioloscoseslri arterioloscosesilr arterioloscosesirl arterioloscosesril arterioloscosesrli
arterioloscoseislr arterioloscoseisrl arterioloscoseilsr arterioloscoseilrs arterioloscoseirls arterioloscoseirsl
arterioloscosersil arterioloscosersli arterioloscoserisl arterioloscoserils arterioloscoserlis arterioloscoserlsi
arterioloscserolis arterioloscserolsi arterioloscseroils arterioloscseroisl arterioloscserosil arterioloscserosli
arterioloscserlois arterioloscserlosi arterioloscserlios arterioloscserliso arterioloscserlsio arterioloscserlsoi
arterioloscserilos arterioloscserilso arterioloscseriols arterioloscseriosl arterioloscserisol arterioloscserislo
arterioloscserslio arterioloscsersloi arterioloscsersilo arterioloscsersiol arterioloscsersoil arterioloscsersoli
arterioloscseorlis arterioloscseorlsi arterioloscseorils arterioloscseorisl arterioloscseorsil arterioloscseorsli
arterioloscseolris arterioloscseolrsi arterioloscseolirs arterioloscseolisr arterioloscseolsir arterioloscseolsri
arterioloscseoilrs arterioloscseoilsr arterioloscseoirls arterioloscseoirsl arterioloscseoisrl arterioloscseoislr
arterioloscseoslir arterioloscseoslri arterioloscseosilr arterioloscseosirl arterioloscseosril arterioloscseosrli
arterioloscseloris arterioloscselorsi arterioloscseloirs arterioloscseloisr arterioloscselosir arterioloscselosri
arterioloscselrois arterioloscselrosi arterioloscselrios arterioloscselriso arterioloscselrsio arterioloscselrsoi
arterioloscseliros arterioloscselirso arterioloscseliors arterioloscseliosr arterioloscselisor arterioloscselisro
arterioloscselsrio arterioloscselsroi arterioloscselsiro arterioloscselsior arterioloscselsoir arterioloscselsori
arterioloscseiolrs arterioloscseiolsr arterioloscseiorls arterioloscseiorsl arterioloscseiosrl arterioloscseioslr
arterioloscseilors arterioloscseilosr arterioloscseilros arterioloscseilrso arterioloscseilsro arterioloscseilsor
arterioloscseirlos arterioloscseirlso arterioloscseirols arterioloscseirosl arterioloscseirsol arterioloscseirslo
arterioloscseislro arterioloscseislor arterioloscseisrlo arterioloscseisrol arterioloscseisorl arterioloscseisolr
arterioloscsesolir arterioloscsesolri arterioloscsesoilr arterioloscsesoirl arterioloscsesoril arterioloscsesorli
arterioloscsesloir arterioloscseslori arterioloscseslior arterioloscsesliro arterioloscseslrio arterioloscseslroi
arterioloscsesilor arterioloscsesilro arterioloscsesiolr arterioloscsesiorl arterioloscsesirol arterioloscsesirlo
arterioloscsesrlio arterioloscsesrloi arterioloscsesrilo arterioloscsesriol arterioloscsesroil arterioloscsesroli
arterioloscsreolis arterioloscsreolsi arterioloscsreoils arterioloscsreoisl arterioloscsreosil arterioloscsreosli
arterioloscsrelois arterioloscsrelosi arterioloscsrelios arterioloscsreliso arterioloscsrelsio arterioloscsrelsoi
arterioloscsreilos arterioloscsreilso arterioloscsreiols arterioloscsreiosl arterioloscsreisol arterioloscsreislo
arterioloscsreslio arterioloscsresloi arterioloscsresilo arterioloscsresiol arterioloscsresoil arterioloscsresoli
arterioloscsroelis arterioloscsroelsi arterioloscsroeils arterioloscsroeisl arterioloscsroesil arterioloscsroesli
arterioloscsroleis arterioloscsrolesi arterioloscsrolies arterioloscsrolise arterioloscsrolsie arterioloscsrolsei
arterioloscsroiles arterioloscsroilse arterioloscsroiels arterioloscsroiesl arterioloscsroisel arterioloscsroisle
arterioloscsroslie arterioloscsroslei arterioloscsrosile arterioloscsrosiel arterioloscsroseil arterioloscsroseli
arterioloscsrloeis arterioloscsrloesi arterioloscsrloies arterioloscsrloise arterioloscsrlosie arterioloscsrlosei
arterioloscsrleois arterioloscsrleosi arterioloscsrleios arterioloscsrleiso arterioloscsrlesio arterioloscsrlesoi
arterioloscsrlieos arterioloscsrlieso arterioloscsrlioes arterioloscsrliose arterioloscsrlisoe arterioloscsrliseo
arterioloscsrlseio arterioloscsrlseoi arterioloscsrlsieo arterioloscsrlsioe arterioloscsrlsoie arterioloscsrlsoei
arterioloscsrioles arterioloscsriolse arterioloscsrioels arterioloscsrioesl arterioloscsriosel arterioloscsriosle
arterioloscsriloes arterioloscsrilose arterioloscsrileos arterioloscsrileso arterioloscsrilseo arterioloscsrilsoe
arterioloscsrielos arterioloscsrielso arterioloscsrieols arterioloscsrieosl arterioloscsriesol arterioloscsrieslo
arterioloscsrisleo arterioloscsrisloe arterioloscsriselo arterioloscsriseol arterioloscsrisoel arterioloscsrisole
arterioloscsrsolie arterioloscsrsolei arterioloscsrsoile arterioloscsrsoiel arterioloscsrsoeil arterioloscsrsoeli
arterioloscsrsloie arterioloscsrsloei arterioloscsrslioe arterioloscsrslieo arterioloscsrsleio arterioloscsrsleoi
arterioloscsrsiloe arterioloscsrsileo arterioloscsrsiole arterioloscsrsioel arterioloscsrsieol arterioloscsrsielo
arterioloscsrselio arterioloscsrseloi arterioloscsrseilo arterioloscsrseiol arterioloscsrseoil arterioloscsrseoli
arterioloscsorelis arterioloscsorelsi arterioloscsoreils arterioloscsoreisl arterioloscsoresil arterioloscsoresli
arterioloscsorleis arterioloscsorlesi arterioloscsorlies arterioloscsorlise arterioloscsorlsie arterioloscsorlsei
arterioloscsoriles arterioloscsorilse arterioloscsoriels arterioloscsoriesl arterioloscsorisel arterioloscsorisle
arterioloscsorslie arterioloscsorslei arterioloscsorsile arterioloscsorsiel arterioloscsorseil arterioloscsorseli
arterioloscsoerlis arterioloscsoerlsi arterioloscsoerils arterioloscsoerisl arterioloscsoersil arterioloscsoersli
arterioloscsoelris arterioloscsoelrsi arterioloscsoelirs arterioloscsoelisr arterioloscsoelsir arterioloscsoelsri
arterioloscsoeilrs arterioloscsoeilsr arterioloscsoeirls arterioloscsoeirsl arterioloscsoeisrl arterioloscsoeislr
arterioloscsoeslir arterioloscsoeslri arterioloscsoesilr arterioloscsoesirl arterioloscsoesril arterioloscsoesrli
arterioloscsoleris arterioloscsolersi arterioloscsoleirs arterioloscsoleisr arterioloscsolesir arterioloscsolesri
arterioloscsolreis arterioloscsolresi arterioloscsolries arterioloscsolrise arterioloscsolrsie arterioloscsolrsei
arterioloscsolires arterioloscsolirse arterioloscsoliers arterioloscsoliesr arterioloscsoliser arterioloscsolisre
arterioloscsolsrie arterioloscsolsrei arterioloscsolsire arterioloscsolsier arterioloscsolseir arterioloscsolseri
arterioloscsoielrs arterioloscsoielsr arterioloscsoierls arterioloscsoiersl arterioloscsoiesrl arterioloscsoieslr
arterioloscsoilers arterioloscsoilesr arterioloscsoilres arterioloscsoilrse arterioloscsoilsre arterioloscsoilser
arterioloscsoirles arterioloscsoirlse arterioloscsoirels arterioloscsoiresl arterioloscsoirsel arterioloscsoirsle
arterioloscsoislre arterioloscsoisler arterioloscsoisrle arterioloscsoisrel arterioloscsoiserl arterioloscsoiselr
arterioloscsoselir arterioloscsoselri arterioloscsoseilr arterioloscsoseirl arterioloscsoseril arterioloscsoserli
arterioloscsosleir arterioloscsosleri arterioloscsoslier arterioloscsoslire arterioloscsoslrie arterioloscsoslrei
arterioloscsosiler arterioloscsosilre arterioloscsosielr arterioloscsosierl arterioloscsosirel arterioloscsosirle
arterioloscsosrlie arterioloscsosrlei arterioloscsosrile arterioloscsosriel arterioloscsosreil arterioloscsosreli
arterioloscslroeis arterioloscslroesi arterioloscslroies arterioloscslroise arterioloscslrosie arterioloscslrosei
arterioloscslreois arterioloscslreosi arterioloscslreios arterioloscslreiso arterioloscslresio arterioloscslresoi
arterioloscslrieos arterioloscslrieso arterioloscslrioes arterioloscslriose arterioloscslrisoe arterioloscslriseo
arterioloscslrseio arterioloscslrseoi arterioloscslrsieo arterioloscslrsioe arterioloscslrsoie arterioloscslrsoei
arterioloscsloreis arterioloscsloresi arterioloscslories arterioloscslorise arterioloscslorsie arterioloscslorsei
arterioloscsloeris arterioloscsloersi arterioloscsloeirs arterioloscsloeisr arterioloscsloesir arterioloscsloesri
arterioloscsloiers arterioloscsloiesr arterioloscsloires arterioloscsloirse arterioloscsloisre arterioloscsloiser
arterioloscsloseir arterioloscsloseri arterioloscslosier arterioloscslosire arterioloscslosrie arterioloscslosrei
arterioloscsleoris arterioloscsleorsi arterioloscsleoirs arterioloscsleoisr arterioloscsleosir arterioloscsleosri
arterioloscslerois arterioloscslerosi arterioloscslerios arterioloscsleriso arterioloscslersio arterioloscslersoi
arterioloscsleiros arterioloscsleirso arterioloscsleiors arterioloscsleiosr arterioloscsleisor arterioloscsleisro
arterioloscslesrio arterioloscslesroi arterioloscslesiro arterioloscslesior arterioloscslesoir arterioloscslesori
arterioloscslioers arterioloscslioesr arterioloscsliores arterioloscsliorse arterioloscsliosre arterioloscslioser
arterioloscslieors arterioloscslieosr arterioloscslieros arterioloscslierso arterioloscsliesro arterioloscsliesor
arterioloscslireos arterioloscslireso arterioloscsliroes arterioloscslirose arterioloscslirsoe arterioloscslirseo
arterioloscslisero arterioloscsliseor arterioloscslisreo arterioloscslisroe arterioloscslisore arterioloscslisoer
arterioloscslsoeir arterioloscslsoeri arterioloscslsoier arterioloscslsoire arterioloscslsorie arterioloscslsorei
arterioloscslseoir arterioloscslseori arterioloscslseior arterioloscslseiro arterioloscslserio arterioloscslseroi
arterioloscslsieor arterioloscslsiero arterioloscslsioer arterioloscslsiore arterioloscslsiroe arterioloscslsireo
arterioloscslsreio arterioloscslsreoi arterioloscslsrieo arterioloscslsrioe arterioloscslsroie arterioloscslsroei
arterioloscsiroles arterioloscsirolse arterioloscsiroels arterioloscsiroesl arterioloscsirosel arterioloscsirosle
arterioloscsirloes arterioloscsirlose arterioloscsirleos arterioloscsirleso arterioloscsirlseo arterioloscsirlsoe
arterioloscsirelos arterioloscsirelso arterioloscsireols arterioloscsireosl arterioloscsiresol arterioloscsireslo
arterioloscsirsleo arterioloscsirsloe arterioloscsirselo arterioloscsirseol arterioloscsirsoel arterioloscsirsole
arterioloscsiorles arterioloscsiorlse arterioloscsiorels arterioloscsioresl arterioloscsiorsel arterioloscsiorsle
arterioloscsiolres arterioloscsiolrse arterioloscsiolers arterioloscsiolesr arterioloscsiolser arterioloscsiolsre
arterioloscsioelrs arterioloscsioelsr arterioloscsioerls arterioloscsioersl arterioloscsioesrl arterioloscsioeslr
arterioloscsiosler arterioloscsioslre arterioloscsioselr arterioloscsioserl arterioloscsiosrel arterioloscsiosrle
arterioloscsilores arterioloscsilorse arterioloscsiloers arterioloscsiloesr arterioloscsiloser arterioloscsilosre
arterioloscsilroes arterioloscsilrose arterioloscsilreos arterioloscsilreso arterioloscsilrseo arterioloscsilrsoe
arterioloscsileros arterioloscsilerso arterioloscsileors arterioloscsileosr arterioloscsilesor arterioloscsilesro
arterioloscsilsreo arterioloscsilsroe arterioloscsilsero arterioloscsilseor arterioloscsilsoer arterioloscsilsore
arterioloscsieolrs arterioloscsieolsr arterioloscsieorls arterioloscsieorsl arterioloscsieosrl arterioloscsieoslr
arterioloscsielors arterioloscsielosr arterioloscsielros arterioloscsielrso arterioloscsielsro arterioloscsielsor
arterioloscsierlos arterioloscsierlso arterioloscsierols arterioloscsierosl arterioloscsiersol arterioloscsierslo
arterioloscsieslro arterioloscsieslor arterioloscsiesrlo arterioloscsiesrol arterioloscsiesorl arterioloscsiesolr
arterioloscsisoler arterioloscsisolre arterioloscsisoelr arterioloscsisoerl arterioloscsisorel arterioloscsisorle
arterioloscsisloer arterioloscsislore arterioloscsisleor arterioloscsislero arterioloscsislreo arterioloscsislroe
arterioloscsiselor arterioloscsiselro arterioloscsiseolr arterioloscsiseorl arterioloscsiserol arterioloscsiserlo
arterioloscsisrleo arterioloscsisrloe arterioloscsisrelo arterioloscsisreol arterioloscsisroel arterioloscsisrole
arterioloscssrolie arterioloscssrolei arterioloscssroile arterioloscssroiel arterioloscssroeil arterioloscssroeli
arterioloscssrloie arterioloscssrloei arterioloscssrlioe arterioloscssrlieo arterioloscssrleio arterioloscssrleoi
arterioloscssriloe arterioloscssrileo arterioloscssriole arterioloscssrioel arterioloscssrieol arterioloscssrielo
arterioloscssrelio arterioloscssreloi arterioloscssreilo arterioloscssreiol arterioloscssreoil arterioloscssreoli
arterioloscssorlie arterioloscssorlei arterioloscssorile arterioloscssoriel arterioloscssoreil arterioloscssoreli
arterioloscssolrie arterioloscssolrei arterioloscssolire arterioloscssolier arterioloscssoleir arterioloscssoleri
arterioloscssoilre arterioloscssoiler arterioloscssoirle arterioloscssoirel arterioloscssoierl arterioloscssoielr
arterioloscssoelir arterioloscssoelri arterioloscssoeilr arterioloscssoeirl arterioloscssoeril arterioloscssoerli
arterioloscsslorie arterioloscsslorei arterioloscssloire arterioloscssloier arterioloscssloeir arterioloscssloeri
arterioloscsslroie arterioloscsslroei arterioloscsslrioe arterioloscsslrieo arterioloscsslreio arterioloscsslreoi
arterioloscssliroe arterioloscsslireo arterioloscssliore arterioloscsslioer arterioloscsslieor arterioloscssliero
arterioloscsslerio arterioloscssleroi arterioloscssleiro arterioloscssleior arterioloscssleoir arterioloscssleori
arterioloscssiolre arterioloscssioler arterioloscssiorle arterioloscssiorel arterioloscssioerl arterioloscssioelr
arterioloscssilore arterioloscssiloer arterioloscssilroe arterioloscssilreo arterioloscssilero arterioloscssileor
arterioloscssirloe arterioloscssirleo arterioloscssirole arterioloscssiroel arterioloscssireol arterioloscssirelo
arterioloscssielro arterioloscssielor arterioloscssierlo arterioloscssierol arterioloscssieorl arterioloscssieolr
arterioloscsseolir arterioloscsseolri arterioloscsseoilr arterioloscsseoirl arterioloscsseoril arterioloscsseorli
arterioloscsseloir arterioloscsselori arterioloscsselior arterioloscsseliro arterioloscsselrio arterioloscsselroi
arterioloscsseilor arterioloscsseilro arterioloscsseiolr arterioloscsseiorl arterioloscsseirol arterioloscsseirlo
arterioloscsserlio arterioloscsserloi arterioloscsserilo arterioloscsseriol arterioloscsseroil arterioloscsseroli
arterioloscierosls arterioloscierossl arterioloscierolss arterioloscierolss arterioloscierosls arterioloscierossl
arteriolosciersols arteriolosciersosl arterioloscierslos arterioloscierslso arteriolosciersslo arterioloscierssol
arterioloscierlsos arterioloscierlsso arterioloscierloss arterioloscierloss arterioloscierlsos arterioloscierlsso
arteriolosciersslo arterioloscierssol arterioloscierslso arterioloscierslos arteriolosciersols arteriolosciersosl
arterioloscieorsls arterioloscieorssl arterioloscieorlss arterioloscieorlss arterioloscieorsls arterioloscieorssl
arterioloscieosrls arterioloscieosrsl arterioloscieoslrs arterioloscieoslsr arterioloscieosslr arterioloscieossrl
arterioloscieolsrs arterioloscieolssr arterioloscieolrss arterioloscieolrss arterioloscieolsrs arterioloscieolssr
arterioloscieosslr arterioloscieossrl arterioloscieoslsr arterioloscieoslrs arterioloscieosrls arterioloscieosrsl
arteriolosciesorls arteriolosciesorsl arteriolosciesolrs arteriolosciesolsr arteriolosciesoslr arteriolosciesosrl
arteriolosciesrols arteriolosciesrosl arteriolosciesrlos arteriolosciesrlso arteriolosciesrslo arteriolosciesrsol
arterioloscieslros arterioloscieslrso arterioloscieslors arterioloscieslosr arterioloscieslsor arterioloscieslsro
arteriolosciessrlo arteriolosciessrol arteriolosciesslro arteriolosciesslor arteriolosciessolr arteriolosciessorl
arterioloscielosrs arterioloscielossr arterioloscielorss arterioloscielorss arterioloscielosrs arterioloscielossr
arterioloscielsors arterioloscielsosr arterioloscielsros arterioloscielsrso arterioloscielssro arterioloscielssor
arterioloscielrsos arterioloscielrsso arterioloscielross arterioloscielross arterioloscielrsos arterioloscielrsso
arterioloscielssro arterioloscielssor arterioloscielsrso arterioloscielsros arterioloscielsors arterioloscielsosr
arteriolosciesoslr arteriolosciesosrl arteriolosciesolsr arteriolosciesolrs arteriolosciesorls arteriolosciesorsl
arteriolosciessolr arteriolosciessorl arteriolosciesslor arteriolosciesslro arteriolosciessrlo arteriolosciessrol
arterioloscieslsor arterioloscieslsro arterioloscieslosr arterioloscieslors arterioloscieslros arterioloscieslrso
arteriolosciesrslo arteriolosciesrsol arteriolosciesrlso arteriolosciesrlos arteriolosciesrols arteriolosciesrosl
arterioloscireosls arterioloscireossl arterioloscireolss arterioloscireolss arterioloscireosls arterioloscireossl
arteriolosciresols arteriolosciresosl arterioloscireslos arterioloscireslso arteriolosciresslo arteriolosciressol
arterioloscirelsos arterioloscirelsso arterioloscireloss arterioloscireloss arterioloscirelsos arterioloscirelsso
arteriolosciresslo arteriolosciressol arterioloscireslso arterioloscireslos arteriolosciresols arteriolosciresosl
arteriolosciroesls arteriolosciroessl arteriolosciroelss arteriolosciroelss arteriolosciroesls arteriolosciroessl
arterioloscirosels arterioloscirosesl arterioloscirosles arteriolosciroslse arterioloscirossle arterioloscirossel
arterioloscirolses arterioloscirolsse arteriolosciroless arteriolosciroless arterioloscirolses arterioloscirolsse
arterioloscirossle arterioloscirossel arteriolosciroslse arterioloscirosles arterioloscirosels arterioloscirosesl
arterioloscirsoels arterioloscirsoesl arterioloscirsoles arterioloscirsolse arterioloscirsosle arterioloscirsosel
arterioloscirseols arterioloscirseosl arterioloscirselos arterioloscirselso arterioloscirseslo arterioloscirsesol
arterioloscirsleos arterioloscirsleso arterioloscirsloes arterioloscirslose arterioloscirslsoe arterioloscirslseo
arterioloscirsselo arterioloscirsseol arterioloscirssleo arterioloscirssloe arterioloscirssole arterioloscirssoel
arterioloscirloses arterioloscirlosse arterioloscirloess arterioloscirloess arterioloscirloses arterioloscirlosse
arterioloscirlsoes arterioloscirlsose arterioloscirlseos arterioloscirlseso arterioloscirlsseo arterioloscirlssoe
arterioloscirlesos arterioloscirlesso arterioloscirleoss arterioloscirleoss arterioloscirlesos arterioloscirlesso
arterioloscirlsseo arterioloscirlssoe arterioloscirlseso arterioloscirlseos arterioloscirlsoes arterioloscirlsose
arterioloscirsosle arterioloscirsosel arterioloscirsolse arterioloscirsoles arterioloscirsoels arterioloscirsoesl
arterioloscirssole arterioloscirssoel arterioloscirssloe arterioloscirssleo arterioloscirsselo arterioloscirsseol
arterioloscirslsoe arterioloscirslseo arterioloscirslose arterioloscirsloes arterioloscirsleos arterioloscirsleso
arterioloscirseslo arterioloscirsesol arterioloscirselso arterioloscirselos arterioloscirseols arterioloscirseosl
arterioloscioresls arterioloscioressl arteriolosciorelss arteriolosciorelss arterioloscioresls arterioloscioressl
arteriolosciorsels arteriolosciorsesl arteriolosciorsles arteriolosciorslse arteriolosciorssle arteriolosciorssel
arteriolosciorlses arteriolosciorlsse arteriolosciorless arteriolosciorless arteriolosciorlses arteriolosciorlsse
arteriolosciorssle arteriolosciorssel arteriolosciorslse arteriolosciorsles arteriolosciorsels arteriolosciorsesl
arterioloscioersls arterioloscioerssl arterioloscioerlss arterioloscioerlss arterioloscioersls arterioloscioerssl
arterioloscioesrls arterioloscioesrsl arterioloscioeslrs arterioloscioeslsr arterioloscioesslr arterioloscioessrl
arterioloscioelsrs arterioloscioelssr arterioloscioelrss arterioloscioelrss arterioloscioelsrs arterioloscioelssr
arterioloscioesslr arterioloscioessrl arterioloscioeslsr arterioloscioeslrs arterioloscioesrls arterioloscioesrsl
arterioloscioserls arteriolosciosersl arterioloscioselrs arterioloscioselsr arterioloscioseslr arteriolosciosesrl
arteriolosciosrels arteriolosciosresl arteriolosciosrles arteriolosciosrlse arteriolosciosrsle arteriolosciosrsel
arterioloscioslres arterioloscioslrse arterioloscioslers arterioloscioslesr arterioloscioslser arterioloscioslsre
arteriolosciossrle arteriolosciossrel arteriolosciosslre arteriolosciossler arteriolosciosselr arteriolosciosserl
arteriolosciolesrs arteriolosciolessr arteriolosciolerss arteriolosciolerss arteriolosciolesrs arteriolosciolessr
arteriolosciolsers arteriolosciolsesr arteriolosciolsres arteriolosciolsrse arteriolosciolssre arteriolosciolsser
arteriolosciolrses arteriolosciolrsse arteriolosciolress arteriolosciolress arteriolosciolrses arteriolosciolrsse
arteriolosciolssre arteriolosciolsser arteriolosciolsrse arteriolosciolsres arteriolosciolsers arteriolosciolsesr
arterioloscioseslr arteriolosciosesrl arterioloscioselsr arterioloscioselrs arterioloscioserls arteriolosciosersl
arteriolosciosselr arteriolosciosserl arteriolosciossler arteriolosciosslre arteriolosciossrle arteriolosciossrel
arterioloscioslser arterioloscioslsre arterioloscioslesr arterioloscioslers arterioloscioslres arterioloscioslrse
arteriolosciosrsle arteriolosciosrsel arteriolosciosrlse arteriolosciosrles arteriolosciosrels arteriolosciosresl
arterioloscisroels arterioloscisroesl arterioloscisroles arterioloscisrolse arterioloscisrosle arterioloscisrosel
arterioloscisreols arterioloscisreosl arterioloscisrelos arterioloscisrelso arterioloscisreslo arterioloscisresol
arterioloscisrleos arterioloscisrleso arterioloscisrloes arterioloscisrlose arterioloscisrlsoe arterioloscisrlseo
arterioloscisrselo arterioloscisrseol arterioloscisrsleo arterioloscisrsloe arterioloscisrsole arterioloscisrsoel
arterioloscisorels arterioloscisoresl arterioloscisorles arterioloscisorlse arterioloscisorsle arterioloscisorsel
arterioloscisoerls arterioloscisoersl arterioloscisoelrs arterioloscisoelsr arterioloscisoeslr arterioloscisoesrl
arterioloscisolers arterioloscisolesr arterioloscisolres arterioloscisolrse arterioloscisolsre arterioloscisolser
arterioloscisoselr arterioloscisoserl arterioloscisosler arterioloscisoslre arterioloscisosrle arterioloscisosrel
arteriolosciseorls arteriolosciseorsl arteriolosciseolrs arteriolosciseolsr arteriolosciseoslr arteriolosciseosrl
arteriolosciserols arteriolosciserosl arteriolosciserlos arteriolosciserlso arteriolosciserslo arterioloscisersol
arteriolosciselros arteriolosciselrso arteriolosciselors arteriolosciselosr arteriolosciselsor arteriolosciselsro
arterioloscisesrlo arterioloscisesrol arteriolosciseslro arteriolosciseslor arterioloscisesolr arterioloscisesorl
arterioloscisloers arterioloscisloesr arterioloscislores arterioloscislorse arterioloscislosre arterioloscisloser
arterioloscisleors arterioloscisleosr arterioloscisleros arterioloscislerso arterioloscislesro arterioloscislesor
arterioloscislreos arterioloscislreso arterioloscislroes arterioloscislrose arterioloscislrsoe arterioloscislrseo
arterioloscislsero arterioloscislseor arterioloscislsreo arterioloscislsroe arterioloscislsore arterioloscislsoer
arterioloscissoelr arterioloscissoerl arterioloscissoler arterioloscissolre arterioloscissorle arterioloscissorel
arterioloscisseolr arterioloscisseorl arterioloscisselor arterioloscisselro arterioloscisserlo arterioloscisserol
arterioloscissleor arterioloscisslero arterioloscissloer arterioloscisslore arterioloscisslroe arterioloscisslreo
arterioloscissrelo arterioloscissreol arterioloscissrleo arterioloscissrloe arterioloscissrole arterioloscissroel
arterioloscilroses arterioloscilrosse arterioloscilroess arterioloscilroess arterioloscilroses arterioloscilrosse
arterioloscilrsoes arterioloscilrsose arterioloscilrseos arterioloscilrseso arterioloscilrsseo arterioloscilrssoe
arterioloscilresos arterioloscilresso arterioloscilreoss arterioloscilreoss arterioloscilresos arterioloscilresso
arterioloscilrsseo arterioloscilrssoe arterioloscilrseso arterioloscilrseos arterioloscilrsoes arterioloscilrsose
arterioloscilorses arterioloscilorsse arteriolosciloress arteriolosciloress arterioloscilorses arterioloscilorsse
arterioloscilosres arterioloscilosrse arterioloscilosers arterioloscilosesr arterioloscilosser arterioloscilossre
arteriolosciloesrs arteriolosciloessr arteriolosciloerss arteriolosciloerss arteriolosciloesrs arteriolosciloessr
arterioloscilosser arterioloscilossre arterioloscilosesr arterioloscilosers arterioloscilosres arterioloscilosrse
arterioloscilsores arterioloscilsorse arterioloscilsoers arterioloscilsoesr arterioloscilsoser arterioloscilsosre
arterioloscilsroes arterioloscilsrose arterioloscilsreos arterioloscilsreso arterioloscilsrseo arterioloscilsrsoe
arterioloscilseros arterioloscilserso arterioloscilseors arterioloscilseosr arterioloscilsesor arterioloscilsesro
arterioloscilssreo arterioloscilssroe arterioloscilssero arterioloscilsseor arterioloscilssoer arterioloscilssore
arterioloscileosrs arterioloscileossr arterioloscileorss arterioloscileorss arterioloscileosrs arterioloscileossr
arterioloscilesors arterioloscilesosr arterioloscilesros arterioloscilesrso arterioloscilessro arterioloscilessor
arterioloscilersos arterioloscilersso arterioloscileross arterioloscileross arterioloscilersos arterioloscilersso
arterioloscilessro arterioloscilessor arterioloscilesrso arterioloscilesros arterioloscilesors arterioloscilesosr
arterioloscilsoser arterioloscilsosre arterioloscilsoesr arterioloscilsoers arterioloscilsores arterioloscilsorse
arterioloscilssoer arterioloscilssore arterioloscilsseor arterioloscilssero arterioloscilssreo arterioloscilssroe
arterioloscilsesor arterioloscilsesro arterioloscilseosr arterioloscilseors arterioloscilseros arterioloscilserso
arterioloscilsrseo arterioloscilsrsoe arterioloscilsreso arterioloscilsreos arterioloscilsroes arterioloscilsrose
arterioloscisrosle arterioloscisrosel arterioloscisrolse arterioloscisroles arterioloscisroels arterioloscisroesl
arterioloscisrsole arterioloscisrsoel arterioloscisrsloe arterioloscisrsleo arterioloscisrselo arterioloscisrseol
arterioloscisrlsoe arterioloscisrlseo arterioloscisrlose arterioloscisrloes arterioloscisrleos arterioloscisrleso
arterioloscisreslo arterioloscisresol arterioloscisrelso arterioloscisrelos arterioloscisreols arterioloscisreosl
arterioloscisorsle arterioloscisorsel arterioloscisorlse arterioloscisorles arterioloscisorels arterioloscisoresl
arterioloscisosrle arterioloscisosrel arterioloscisoslre arterioloscisosler arterioloscisoselr arterioloscisoserl
arterioloscisolsre arterioloscisolser arterioloscisolrse arterioloscisolres arterioloscisolers arterioloscisolesr
arterioloscisoeslr arterioloscisoesrl arterioloscisoelsr arterioloscisoelrs arterioloscisoerls arterioloscisoersl
arterioloscissorle arterioloscissorel arterioloscissolre arterioloscissoler arterioloscissoelr arterioloscissoerl
arterioloscissrole arterioloscissroel arterioloscissrloe arterioloscissrleo arterioloscissrelo arterioloscissreol
arterioloscisslroe arterioloscisslreo arterioloscisslore arterioloscissloer arterioloscissleor arterioloscisslero
arterioloscisserlo arterioloscisserol arterioloscisselro arterioloscisselor arterioloscisseolr arterioloscisseorl
arterioloscislosre arterioloscisloser arterioloscislorse arterioloscislores arterioloscisloers arterioloscisloesr
arterioloscislsore arterioloscislsoer arterioloscislsroe arterioloscislsreo arterioloscislsero arterioloscislseor
arterioloscislrsoe arterioloscislrseo arterioloscislrose arterioloscislroes arterioloscislreos arterioloscislreso
arterioloscislesro arterioloscislesor arterioloscislerso arterioloscisleros arterioloscisleors arterioloscisleosr
arteriolosciseoslr arteriolosciseosrl arteriolosciseolsr arteriolosciseolrs arteriolosciseorls arteriolosciseorsl
arterioloscisesolr arterioloscisesorl arteriolosciseslor arteriolosciseslro arterioloscisesrlo arterioloscisesrol
arteriolosciselsor arteriolosciselsro arteriolosciselosr arteriolosciselors arteriolosciselros arteriolosciselrso
arteriolosciserslo arterioloscisersol arteriolosciserlso arteriolosciserlos arteriolosciserols arteriolosciserosl
arterioloscserosil arterioloscserosli arterioloscseroisl arterioloscseroils arterioloscserolis arterioloscserolsi
arterioloscsersoil arterioloscsersoli arterioloscsersiol arterioloscsersilo arterioloscserslio arterioloscsersloi
arterioloscserisol arterioloscserislo arterioloscseriosl arterioloscseriols arterioloscserilos arterioloscserilso
arterioloscserlsio arterioloscserlsoi arterioloscserliso arterioloscserlios arterioloscserlois arterioloscserlosi
arterioloscseorsil arterioloscseorsli arterioloscseorisl arterioloscseorils arterioloscseorlis arterioloscseorlsi
arterioloscseosril arterioloscseosrli arterioloscseosirl arterioloscseosilr arterioloscseoslir arterioloscseoslri
arterioloscseoisrl arterioloscseoislr arterioloscseoirsl arterioloscseoirls arterioloscseoilrs arterioloscseoilsr
arterioloscseolsir arterioloscseolsri arterioloscseolisr arterioloscseolirs arterioloscseolris arterioloscseolrsi
arterioloscsesoril arterioloscsesorli arterioloscsesoirl arterioloscsesoilr arterioloscsesolir arterioloscsesolri
arterioloscsesroil arterioloscsesroli arterioloscsesriol arterioloscsesrilo arterioloscsesrlio arterioloscsesrloi
arterioloscsesirol arterioloscsesirlo arterioloscsesiorl arterioloscsesiolr arterioloscsesilor arterioloscsesilro
arterioloscseslrio arterioloscseslroi arterioloscsesliro arterioloscseslior arterioloscsesloir arterioloscseslori
arterioloscseiosrl arterioloscseioslr arterioloscseiorsl arterioloscseiorls arterioloscseiolrs arterioloscseiolsr
arterioloscseisorl arterioloscseisolr arterioloscseisrol arterioloscseisrlo arterioloscseislro arterioloscseislor
arterioloscseirsol arterioloscseirslo arterioloscseirosl arterioloscseirols arterioloscseirlos arterioloscseirlso
arterioloscseilsro arterioloscseilsor arterioloscseilrso arterioloscseilros arterioloscseilors arterioloscseilosr
arterioloscselosir arterioloscselosri arterioloscseloisr arterioloscseloirs arterioloscseloris arterioloscselorsi
arterioloscselsoir arterioloscselsori arterioloscselsior arterioloscselsiro arterioloscselsrio arterioloscselsroi
arterioloscselisor arterioloscselisro arterioloscseliosr arterioloscseliors arterioloscseliros arterioloscselirso
arterioloscselrsio arterioloscselrsoi arterioloscselriso arterioloscselrios arterioloscselrois arterioloscselrosi
arterioloscsreosil arterioloscsreosli arterioloscsreoisl arterioloscsreoils arterioloscsreolis arterioloscsreolsi
arterioloscsresoil arterioloscsresoli arterioloscsresiol arterioloscsresilo arterioloscsreslio arterioloscsresloi
arterioloscsreisol arterioloscsreislo arterioloscsreiosl arterioloscsreiols arterioloscsreilos arterioloscsreilso
arterioloscsrelsio arterioloscsrelsoi arterioloscsreliso arterioloscsrelios arterioloscsrelois arterioloscsrelosi
arterioloscsroesil arterioloscsroesli arterioloscsroeisl arterioloscsroeils arterioloscsroelis arterioloscsroelsi
arterioloscsroseil arterioloscsroseli arterioloscsrosiel arterioloscsrosile arterioloscsroslie arterioloscsroslei
arterioloscsroisel arterioloscsroisle arterioloscsroiesl arterioloscsroiels arterioloscsroiles arterioloscsroilse
arterioloscsrolsie arterioloscsrolsei arterioloscsrolise arterioloscsrolies arterioloscsroleis arterioloscsrolesi
arterioloscsrsoeil arterioloscsrsoeli arterioloscsrsoiel arterioloscsrsoile arterioloscsrsolie arterioloscsrsolei
arterioloscsrseoil arterioloscsrseoli arterioloscsrseiol arterioloscsrseilo arterioloscsrselio arterioloscsrseloi
arterioloscsrsieol arterioloscsrsielo arterioloscsrsioel arterioloscsrsiole arterioloscsrsiloe arterioloscsrsileo
arterioloscsrsleio arterioloscsrsleoi arterioloscsrslieo arterioloscsrslioe arterioloscsrsloie arterioloscsrsloei
arterioloscsriosel arterioloscsriosle arterioloscsrioesl arterioloscsrioels arterioloscsrioles arterioloscsriolse
arterioloscsrisoel arterioloscsrisole arterioloscsriseol arterioloscsriselo arterioloscsrisleo arterioloscsrisloe
arterioloscsriesol arterioloscsrieslo arterioloscsrieosl arterioloscsrieols arterioloscsrielos arterioloscsrielso
arterioloscsrilseo arterioloscsrilsoe arterioloscsrileso arterioloscsrileos arterioloscsriloes arterioloscsrilose
arterioloscsrlosie arterioloscsrlosei arterioloscsrloise arterioloscsrloies arterioloscsrloeis arterioloscsrloesi
arterioloscsrlsoie arterioloscsrlsoei arterioloscsrlsioe arterioloscsrlsieo arterioloscsrlseio arterioloscsrlseoi
arterioloscsrlisoe arterioloscsrliseo arterioloscsrliose arterioloscsrlioes arterioloscsrlieos arterioloscsrlieso
arterioloscsrlesio arterioloscsrlesoi arterioloscsrleiso arterioloscsrleios arterioloscsrleois arterioloscsrleosi
arterioloscsoresil arterioloscsoresli arterioloscsoreisl arterioloscsoreils arterioloscsorelis arterioloscsorelsi
arterioloscsorseil arterioloscsorseli arterioloscsorsiel arterioloscsorsile arterioloscsorslie arterioloscsorslei
arterioloscsorisel arterioloscsorisle arterioloscsoriesl arterioloscsoriels arterioloscsoriles arterioloscsorilse
arterioloscsorlsie arterioloscsorlsei arterioloscsorlise arterioloscsorlies arterioloscsorleis arterioloscsorlesi
arterioloscsoersil arterioloscsoersli arterioloscsoerisl arterioloscsoerils arterioloscsoerlis arterioloscsoerlsi
arterioloscsoesril arterioloscsoesrli arterioloscsoesirl arterioloscsoesilr arterioloscsoeslir arterioloscsoeslri
arterioloscsoeisrl arterioloscsoeislr arterioloscsoeirsl arterioloscsoeirls arterioloscsoeilrs arterioloscsoeilsr
arterioloscsoelsir arterioloscsoelsri arterioloscsoelisr arterioloscsoelirs arterioloscsoelris arterioloscsoelrsi
arterioloscsoseril arterioloscsoserli arterioloscsoseirl arterioloscsoseilr arterioloscsoselir arterioloscsoselri
arterioloscsosreil arterioloscsosreli arterioloscsosriel arterioloscsosrile arterioloscsosrlie arterioloscsosrlei
arterioloscsosirel arterioloscsosirle arterioloscsosierl arterioloscsosielr arterioloscsosiler arterioloscsosilre
arterioloscsoslrie arterioloscsoslrei arterioloscsoslire arterioloscsoslier arterioloscsosleir arterioloscsosleri
arterioloscsoiesrl arterioloscsoieslr arterioloscsoiersl arterioloscsoierls arterioloscsoielrs arterioloscsoielsr
arterioloscsoiserl arterioloscsoiselr arterioloscsoisrel arterioloscsoisrle arterioloscsoislre arterioloscsoisler
arterioloscsoirsel arterioloscsoirsle arterioloscsoiresl arterioloscsoirels arterioloscsoirles arterioloscsoirlse
arterioloscsoilsre arterioloscsoilser arterioloscsoilrse arterioloscsoilres arterioloscsoilers arterioloscsoilesr
arterioloscsolesir arterioloscsolesri arterioloscsoleisr arterioloscsoleirs arterioloscsoleris arterioloscsolersi
arterioloscsolseir arterioloscsolseri arterioloscsolsier arterioloscsolsire arterioloscsolsrie arterioloscsolsrei
arterioloscsoliser arterioloscsolisre arterioloscsoliesr arterioloscsoliers arterioloscsolires arterioloscsolirse
arterioloscsolrsie arterioloscsolrsei arterioloscsolrise arterioloscsolries arterioloscsolreis arterioloscsolresi
arterioloscssroeil arterioloscssroeli arterioloscssroiel arterioloscssroile arterioloscssrolie arterioloscssrolei
arterioloscssreoil arterioloscssreoli arterioloscssreiol arterioloscssreilo arterioloscssrelio arterioloscssreloi
arterioloscssrieol arterioloscssrielo arterioloscssrioel arterioloscssriole arterioloscssriloe arterioloscssrileo
arterioloscssrleio arterioloscssrleoi arterioloscssrlieo arterioloscssrlioe arterioloscssrloie arterioloscssrloei
arterioloscssoreil arterioloscssoreli arterioloscssoriel arterioloscssorile arterioloscssorlie arterioloscssorlei
arterioloscssoeril arterioloscssoerli arterioloscssoeirl arterioloscssoeilr arterioloscssoelir arterioloscssoelri
arterioloscssoierl arterioloscssoielr arterioloscssoirel arterioloscssoirle arterioloscssoilre arterioloscssoiler
arterioloscssoleir arterioloscssoleri arterioloscssolier arterioloscssolire arterioloscssolrie arterioloscssolrei
arterioloscsseoril arterioloscsseorli arterioloscsseoirl arterioloscsseoilr arterioloscsseolir arterioloscsseolri
arterioloscsseroil arterioloscsseroli arterioloscsseriol arterioloscsserilo arterioloscsserlio arterioloscsserloi
arterioloscsseirol arterioloscsseirlo arterioloscsseiorl arterioloscsseiolr arterioloscsseilor arterioloscsseilro
arterioloscsselrio arterioloscsselroi arterioloscsseliro arterioloscsselior arterioloscsseloir arterioloscsselori
arterioloscssioerl arterioloscssioelr arterioloscssiorel arterioloscssiorle arterioloscssiolre arterioloscssioler
arterioloscssieorl arterioloscssieolr arterioloscssierol arterioloscssierlo arterioloscssielro arterioloscssielor
arterioloscssireol arterioloscssirelo arterioloscssiroel arterioloscssirole arterioloscssirloe arterioloscssirleo
arterioloscssilero arterioloscssileor arterioloscssilreo arterioloscssilroe arterioloscssilore arterioloscssiloer
arterioloscssloeir arterioloscssloeri arterioloscssloier arterioloscssloire arterioloscsslorie arterioloscsslorei
arterioloscssleoir arterioloscssleori arterioloscssleior arterioloscssleiro arterioloscsslerio arterioloscssleroi
arterioloscsslieor arterioloscssliero arterioloscsslioer arterioloscssliore arterioloscssliroe arterioloscsslireo
arterioloscsslreio arterioloscsslreoi arterioloscsslrieo arterioloscsslrioe arterioloscsslroie arterioloscsslroei
arterioloscsirosel arterioloscsirosle arterioloscsiroesl arterioloscsiroels arterioloscsiroles arterioloscsirolse
arterioloscsirsoel arterioloscsirsole arterioloscsirseol arterioloscsirselo arterioloscsirsleo arterioloscsirsloe
arterioloscsiresol arterioloscsireslo arterioloscsireosl arterioloscsireols arterioloscsirelos arterioloscsirelso
arterioloscsirlseo arterioloscsirlsoe arterioloscsirleso arterioloscsirleos arterioloscsirloes arterioloscsirlose
arterioloscsiorsel arterioloscsiorsle arterioloscsioresl arterioloscsiorels arterioloscsiorles arterioloscsiorlse
arterioloscsiosrel arterioloscsiosrle arterioloscsioserl arterioloscsioselr arterioloscsiosler arterioloscsioslre
arterioloscsioesrl arterioloscsioeslr arterioloscsioersl arterioloscsioerls arterioloscsioelrs arterioloscsioelsr
arterioloscsiolser arterioloscsiolsre arterioloscsiolesr arterioloscsiolers arterioloscsiolres arterioloscsiolrse
arterioloscsisorel arterioloscsisorle arterioloscsisoerl arterioloscsisoelr arterioloscsisoler arterioloscsisolre
arterioloscsisroel arterioloscsisrole arterioloscsisreol arterioloscsisrelo arterioloscsisrleo arterioloscsisrloe
arterioloscsiserol arterioloscsiserlo arterioloscsiseorl arterioloscsiseolr arterioloscsiselor arterioloscsiselro
arterioloscsislreo arterioloscsislroe arterioloscsislero arterioloscsisleor arterioloscsisloer arterioloscsislore
arterioloscsieosrl arterioloscsieoslr arterioloscsieorsl arterioloscsieorls arterioloscsieolrs arterioloscsieolsr
arterioloscsiesorl arterioloscsiesolr arterioloscsiesrol arterioloscsiesrlo arterioloscsieslro arterioloscsieslor
arterioloscsiersol arterioloscsierslo arterioloscsierosl arterioloscsierols arterioloscsierlos arterioloscsierlso
arterioloscsielsro arterioloscsielsor arterioloscsielrso arterioloscsielros arterioloscsielors arterioloscsielosr
arterioloscsiloser arterioloscsilosre arterioloscsiloesr arterioloscsiloers arterioloscsilores arterioloscsilorse
arterioloscsilsoer arterioloscsilsore arterioloscsilseor arterioloscsilsero arterioloscsilsreo arterioloscsilsroe
arterioloscsilesor arterioloscsilesro arterioloscsileosr arterioloscsileors arterioloscsileros arterioloscsilerso
arterioloscsilrseo arterioloscsilrsoe arterioloscsilreso arterioloscsilreos arterioloscsilroes arterioloscsilrose
arterioloscslrosie arterioloscslrosei arterioloscslroise arterioloscslroies arterioloscslroeis arterioloscslroesi
arterioloscslrsoie arterioloscslrsoei arterioloscslrsioe arterioloscslrsieo arterioloscslrseio arterioloscslrseoi
arterioloscslrisoe arterioloscslriseo arterioloscslriose arterioloscslrioes arterioloscslrieos arterioloscslrieso
arterioloscslresio arterioloscslresoi arterioloscslreiso arterioloscslreios arterioloscslreois arterioloscslreosi
arterioloscslorsie arterioloscslorsei arterioloscslorise arterioloscslories arterioloscsloreis arterioloscsloresi
arterioloscslosrie arterioloscslosrei arterioloscslosire arterioloscslosier arterioloscsloseir arterioloscsloseri
arterioloscsloisre arterioloscsloiser arterioloscsloirse arterioloscsloires arterioloscsloiers arterioloscsloiesr
arterioloscsloesir arterioloscsloesri arterioloscsloeisr arterioloscsloeirs arterioloscsloeris arterioloscsloersi
arterioloscslsorie arterioloscslsorei arterioloscslsoire arterioloscslsoier arterioloscslsoeir arterioloscslsoeri
arterioloscslsroie arterioloscslsroei arterioloscslsrioe arterioloscslsrieo arterioloscslsreio arterioloscslsreoi
arterioloscslsiroe arterioloscslsireo arterioloscslsiore arterioloscslsioer arterioloscslsieor arterioloscslsiero
arterioloscslserio arterioloscslseroi arterioloscslseiro arterioloscslseior arterioloscslseoir arterioloscslseori
arterioloscsliosre arterioloscslioser arterioloscsliorse arterioloscsliores arterioloscslioers arterioloscslioesr
arterioloscslisore arterioloscslisoer arterioloscslisroe arterioloscslisreo arterioloscslisero arterioloscsliseor
arterioloscslirsoe arterioloscslirseo arterioloscslirose arterioloscsliroes arterioloscslireos arterioloscslireso
arterioloscsliesro arterioloscsliesor arterioloscslierso arterioloscslieros arterioloscslieors arterioloscslieosr
arterioloscsleosir arterioloscsleosri arterioloscsleoisr arterioloscsleoirs arterioloscsleoris arterioloscsleorsi
arterioloscslesoir arterioloscslesori arterioloscslesior arterioloscslesiro arterioloscslesrio arterioloscslesroi
arterioloscsleisor arterioloscsleisro arterioloscsleiosr arterioloscsleiors arterioloscsleiros arterioloscsleirso
arterioloscslersio arterioloscslersoi arterioloscsleriso arterioloscslerios arterioloscslerois arterioloscslerosi

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us