easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

poetize

pregrade

migun

leprae

kamilla

homeocrystalline

repressedly

extrapoetical

telecode

bychkov

bolloxing

awabakal

ambiguus

thermosipho

monsoon

kayla

antialdoxime

makable


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: aranda
cipher variations:
bsboeb ctcpfc dudqgd everhe fwfsif
gxgtjg hyhukh izivli jajwmj kbkxnk
lclyol mdmzpm nenaqn ofobro pgpcsp
qhqdtq rireur sjsfvs tktgwt uluhxu
vmviyv wnwjzw xoxkax ypylby zqzmcz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: aranda
Cipher: zizmwz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: aranda
Cipher: AAAAA BAAAA AAAAA ABBAA AAABB AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: aranda
cipher variations:
bsboebbabokbbiboqbbqbowbbybocbbgboibbwboubbeboab
bmbogbbubombbcbosbbkboybctcpfccbcplccjcprccrcpxc
czcpdcchcpjccxcpvccfcpbccncphccvcpnccdcptcclcpzc
dudqgddcdqmddkdqsddsdqyddadqeddidqkddydqwddgdqcd
dodqiddwdqoddedquddmdqadeverheederneelerteeterze
eberfeejerleezerxeeherdeeperjeexerpeeferveenerbe
fwfsiffefsoffmfsuffufsaffcfsgffkfsmffafsyffifsef
fqfskffyfsqffgfswffofscfgxgtjggfgtpggngtvggvgtbg
gdgthgglgtnggbgtzggjgtfggrgtlggzgtrgghgtxggpgtdg
hyhukhhghuqhhohuwhhwhuchhehuihhmhuohhchuahhkhugh
hshumhhahushhihuyhhqhuehizivliihivriipivxiixivdi
ifivjiinivpiidivbiilivhiitivniibivtiijivziirivfi
jajwmjjijwsjjqjwyjjyjwejjgjwkjjojwqjjejwcjjmjwij
jujwojjcjwujjkjwajjsjwgjkbkxnkkjkxtkkrkxzkkzkxfk
khkxlkkpkxrkkfkxdkknkxjkkvkxpkkdkxvkklkxbkktkxhk
lclyollklyullslyallalygllilymllqlysllglyellolykl
lwlyqllelywllmlycllulyilmdmzpmmlmzvmmtmzbmmbmzhm
mjmznmmrmztmmhmzfmmpmzlmmxmzrmmfmzxmmnmzdmmvmzjm
nenaqnnmnawnnunacnncnainnknaonnsnaunninagnnqnamn
nynasnngnaynnonaennwnaknofobroonobxoovobdoodobjo
olobpootobvoojobhoorobnoozobtoohobzoopobfooxoblo
pgpcsppopcyppwpceppepckppmpcqppupcwppkpcippspcop
papcuppipcappqpcgppypcmpqhqdtqqpqdzqqxqdfqqfqdlq
qnqdrqqvqdxqqlqdjqqtqdpqqbqdvqqjqdbqqrqdhqqzqdnq
rireurrqrearryregrrgremrroresrrwreyrrmrekrrureqr
rcrewrrkrecrrsreirrareorsjsfvssrsfbsszsfhsshsfns
spsftssxsfzssnsflssvsfrssdsfxsslsfdsstsfjssbsfps
tktgwttstgcttatgittitgottqtguttytgattotgmttwtgst
tetgyttmtgettutgkttctgqtuluhxuutuhduubuhjuujuhpu
uruhvuuzuhbuupuhnuuxuhtuufuhzuunuhfuuvuhluuduhru
vmviyvvuvievvcvikvvkviqvvsviwvvavicvvqviovvyviuv
vgviavvovigvvwvimvvevisvwnwjzwwvwjfwwdwjlwwlwjrw
wtwjxwwbwjdwwrwjpwwzwjvwwhwjbwwpwjhwwxwjnwwfwjtw
xoxkaxxwxkgxxexkmxxmxksxxuxkyxxcxkexxsxkqxxaxkwx
xixkcxxqxkixxyxkoxxgxkuxypylbyyxylhyyfylnyynylty
yvylzyydylfyytylryybylxyyjyldyyryljyyzylpyyhylvy
zqzmczzyzmizzgzmozzozmuzzwzmazzezmgzzuzmszzczmyz
zkzmezzszmkzzazmqzzizmwzarandaazanjaahanpaapanva
axanbaafanhaavantaadanzaalanfaatanlaabanraajanxa

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: aranda
Cipher: nenaqn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: aranda
Cipher: 112411334111

Extended Methods:
Method #1

Plaintext: aranda
method variations:
fwfsiflblxolqgqctqvmvhyv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a r a n d a 
1 2 1 3 4 1 
1 4 1 3 1 1 
They are then read out in rows:
121341141311
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: aranda
Cipher: fldqla

Read more ...
Method #3

Plaintext: aranda
method variations:
fdlsaa dlsaaf lsaafd
saafdl aafdls afdlsa

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: aranda

all 720 cipher variations:
aranda aranad aradna aradan araadn araand arnada arnaad arndaa arndaa arnada
arnaad ardnaa ardnaa ardana ardaan ardaan ardana aranda aranad aradna aradan
araadn araand aarnda aarnad aardna aardan aaradn aarand aanrda aanrad aandra
aandar aanadr aanard aadnra aadnar aadrna aadran aadarn aadanr aaandr aaanrd
aaadnr aaadrn aaardn aaarnd anarda anarad anadra anadar anaadr anaard anrada
anraad anrdaa anrdaa anrada anraad andraa andraa andara andaar andaar andara
anarda anarad anadra anadar anaadr anaard adanra adanar adarna adaran adaarn
adaanr adnara adnaar adnraa adnraa adnara adnaar adrnaa adrnaa adrana adraan
adraan adrana adanra adanar adarna adaran adaarn adaanr aaandr aaanrd aaadnr
aaadrn aaardn aaarnd aanadr aanard aandar aandra aanrda aanrad aadnar aadnra
aadanr aadarn aadran aadrna aarnda aarnad aardna aardan aaradn aarand raanda
raanad raadna raadan raaadn raaand ranada ranaad randaa randaa ranada ranaad
radnaa radnaa radana radaan radaan radana raanda raanad raadna raadan raaadn
raaand raanda raanad raadna raadan raaadn raaand ranada ranaad randaa randaa
ranada ranaad radnaa radnaa radana radaan radaan radana raanda raanad raadna
raadan raaadn raaand rnaada rnaaad rnadaa rnadaa rnaada rnaaad rnaada rnaaad
rnadaa rnadaa rnaada rnaaad rndaaa rndaaa rndaaa rndaaa rndaaa rndaaa rnaada
rnaaad rnadaa rnadaa rnaada rnaaad rdanaa rdanaa rdaana rdaaan rdaaan rdaana
rdnaaa rdnaaa rdnaaa rdnaaa rdnaaa rdnaaa rdanaa rdanaa rdaana rdaaan rdaaan
rdaana rdanaa rdanaa rdaana rdaaan rdaaan rdaana raanda raanad raadna raadan
raaadn raaand ranada ranaad randaa randaa ranada ranaad radnaa radnaa radana
radaan radaan radana raanda raanad raadna raadan raaadn raaand aranda aranad
aradna aradan araadn araand arnada arnaad arndaa arndaa arnada arnaad ardnaa
ardnaa ardana ardaan ardaan ardana aranda aranad aradna aradan araadn araand
aarnda aarnad aardna aardan aaradn aarand aanrda aanrad aandra aandar aanadr
aanard aadnra aadnar aadrna aadran aadarn aadanr aaandr aaanrd aaadnr aaadrn
aaardn aaarnd anarda anarad anadra anadar anaadr anaard anrada anraad anrdaa
anrdaa anrada anraad andraa andraa andara andaar andaar andara anarda anarad
anadra anadar anaadr anaard adanra adanar adarna adaran adaarn adaanr adnara
adnaar adnraa adnraa adnara adnaar adrnaa adrnaa adrana adraan adraan adrana
adanra adanar adarna adaran adaarn adaanr aaandr aaanrd aaadnr aaadrn aaardn
aaarnd aanadr aanard aandar aandra aanrda aanrad aadnar aadnra aadanr aadarn
aadran aadrna aarnda aarnad aardna aardan aaradn aarand nraada nraaad nradaa
nradaa nraada nraaad nraada nraaad nradaa nradaa nraada nraaad nrdaaa nrdaaa
nrdaaa nrdaaa nrdaaa nrdaaa nraada nraaad nradaa nradaa nraada nraaad narada
naraad nardaa nardaa narada naraad naarda naarad naadra naadar naaadr naaard
nadara nadaar nadraa nadraa nadara nadaar naaadr naaard naadar naadra naarda
naarad naarda naarad naadra naadar naaadr naaard narada naraad nardaa nardaa
narada naraad nadraa nadraa nadara nadaar nadaar nadara naarda naarad naadra
naadar naaadr naaard ndaara ndaaar ndaraa ndaraa ndaara ndaaar ndaara ndaaar
ndaraa ndaraa ndaara ndaaar ndraaa ndraaa ndraaa ndraaa ndraaa ndraaa ndaara
ndaaar ndaraa ndaraa ndaara ndaaar naaadr naaard naadar naadra naarda naarad
naaadr naaard naadar naadra naarda naarad nadaar nadara nadaar nadara nadraa
nadraa narada naraad nardaa nardaa narada naraad dranaa dranaa draana draaan
draaan draana drnaaa drnaaa drnaaa drnaaa drnaaa drnaaa dranaa dranaa draana
draaan draaan draana dranaa dranaa draana draaan draaan draana darnaa darnaa
darana daraan daraan darana danraa danraa danara danaar danaar danara daanra
daanar daarna daaran daaarn daaanr daanar daanra daaanr daaarn daaran daarna
dnaraa dnaraa dnaara dnaaar dnaaar dnaara dnraaa dnraaa dnraaa dnraaa dnraaa
dnraaa dnaraa dnaraa dnaara dnaaar dnaaar dnaara dnaraa dnaraa dnaara dnaaar
dnaaar dnaara daanra daanar daarna daaran daaarn daaanr danara danaar danraa
danraa danara danaar darnaa darnaa darana daraan daraan darana daanra daanar
daarna daaran daaarn daaanr daanar daanra daaanr daaarn daaran daarna danaar
danara danaar danara danraa danraa daanar daanra daaanr daaarn daaran daarna
darnaa darnaa darana daraan daraan darana aranda aranad aradna aradan araadn
araand arnada arnaad arndaa arndaa arnada arnaad ardnaa ardnaa ardana ardaan
ardaan ardana aranda aranad aradna aradan araadn araand aarnda aarnad aardna
aardan aaradn aarand aanrda aanrad aandra aandar aanadr aanard aadnra aadnar
aadrna aadran aadarn aadanr aaandr aaanrd aaadnr aaadrn aaardn aaarnd anarda
anarad anadra anadar anaadr anaard anrada anraad anrdaa anrdaa anrada anraad
andraa andraa andara andaar andaar andara anarda anarad anadra anadar anaadr
anaard adanra adanar adarna adaran adaarn adaanr adnara adnaar adnraa adnraa
adnara adnaar adrnaa adrnaa adrana adraan adraan adrana adanra adanar adarna
adaran adaarn adaanr aaandr aaanrd aaadnr aaadrn aaardn aaarnd aanadr aanard
aandar aandra aanrda aanrad aadnar aadnra aadanr aadarn aadran aadrna aarnda
aarnad aardna aardan aaradn aarand

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us