easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

vidaurri

wandery

warschitz

grapta

wiggle

uolueritque

belloq

moldings

lodgment

isonitroso

veyden

kristinae

timebunt

sequent

appraisement

darosa

sternways

circumdatus


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: aquatica
cipher variations:
brvbujdb cswcvkec dtxdwlfd euyexmge fvzfynhf
gwagzoig hxbhapjh iycibqki jzdjcrlj kaekdsmk
lbfletnl mcgmfuom ndhngvpn oeiohwqo pfjpixrp
qgkqjysq rhlrkztr simslaus tjntmbvt ukouncwu
vlpvodxv wmqwpeyw xnrxqfzx yosyrgay zptzshbz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: aquatica
Cipher: zjfzgrxz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: aquatica
Cipher: AAAAA ABBBB BAABB AAAAA BAABA ABAAA AAABA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: aquatica
cipher variations:
brvbujdbbxjbgzhbbdxbsplbbjlbefpbbpzbqvtbbvnbclxbbhpbarfbbndbmhjb
btrbyxnbbzfbknrbbftbwdvbblhbitzbcswcvkeccykchaicceyctqmcckmcfgqc
cqacrwuccwocdmycciqcbsgccoecnikccusczyoccagclosccgucxewccmicjuac
dtxdwlfddzldibjddfzdurnddlndghrddrbdsxvddxpdenzddjrdcthddpfdojld
dvtdazpddbhdmptddhvdyfxddnjdkvbdeuyexmgeeamejckeegaevsoeemoehise
escetyweeyqefoaeekseduieeqgepkmeewuebaqeecienqueeiwezgyeeokelwce
fvzfynhffbnfkdlffhbfwtpffnpfijtfftdfuzxffzrfgpbffltfevjffrhfqlnf
fxvfcbrffdjforvffjxfahzffplfmxdfgwagzoiggcoglemggicgxuqggoqgjkug
guegvayggasghqcggmugfwkggsigrmoggywgdcsggekgpswggkygbiaggqmgnyeg
hxbhapjhhdphmfnhhjdhyvrhhprhklvhhvfhwbzhhbthirdhhnvhgxlhhtjhsnph
hzxhedthhflhqtxhhlzhcjbhhrnhozfhiycibqkiieqingoiikeizwsiiqsilmwi
iwgixcaiicuijseiiowihymiiukitoqiiayifeuiigmiruyiimaidkciisoipagi
jzdjcrljjfrjohpjjlfjaxtjjrtjmnxjjxhjydbjjdvjktfjjpxjiznjjvljuprj
jbzjgfvjjhnjsvzjjnbjeldjjtpjqbhjkaekdsmkkgskpiqkkmgkbyukksuknoyk
kyikzeckkewklugkkqykjaokkwmkvqskkcakhgwkkioktwakkockfmekkuqkrcik
lbfletnllhtlqjrllnhlczvlltvlopzllzjlafdllfxlmvhllrzlkbpllxnlwrtl
ldblihxlljpluxbllpdlgnfllvrlsdjlmcgmfuommiumrksmmoimdawmmuwmpqam
makmbgemmgymnwimmsamlcqmmyomxsummecmjiymmkqmvycmmqemhogmmwsmtekm
ndhngvpnnjvnsltnnpjnebxnnvxnqrbnnblnchfnnhznoxjnntbnmdrnnzpnytvn
nfdnkjznnlrnwzdnnrfniphnnxtnuflnoeiohwqookwotmuooqkofcyoowyorsco
ocmodigooiaopykoouconesooaqozuwoogeolkaoomsoxaeoosgojqiooyuovgmo
pfjpixrpplxpunvpprlpgdzppxzpstdppdnpejhppjbpqzlppvdpoftppbrpavxp
phfpmlbppntpybfppthpkrjppzvpwhnpqgkqjysqqmyqvowqqsmqheaqqyaqtueq
qeoqfkiqqkcqramqqweqpguqqcsqbwyqqigqnmcqqouqzcgqquiqlskqqawqxioq
rhlrkztrrnzrwpxrrtnrifbrrzbruvfrrfprgljrrldrsbnrrxfrqhvrrdtrcxzr
rjhrondrrpvradhrrvjrmtlrrbxryjprsimslaussoasxqyssuosjgcssacsvwgs
sgqshmkssmestcossygsriwsseusdyasskispoessqwsbeisswksnumsscyszkqs
tjntmbvttpbtyrzttvptkhdttbdtwxhtthrtinlttnftudpttzhtsjxttfvtezbt
tljtqpfttrxtcfjttxltovnttdztalrtukouncwuuqcuzsauuwqulieuuceuxyiu
uisujomuuoguvequuaiutkyuugwufacuumkurqguusyudgkuuymupwouueaubmsu
vlpvodxvvrdvatbvvxrvmjfvvdfvyzjvvjtvkpnvvphvwfrvvbjvulzvvhxvgbdv
vnlvsrhvvtzvehlvvznvqxpvvfbvcntvwmqwpeywwsewbucwwyswnkgwwegwzakw
wkuwlqowwqiwxgswwckwvmawwiywhcewwomwtsiwwuawfimwwaowryqwwgcwdouw
xnrxqfzxxtfxcvdxxztxolhxxfhxablxxlvxmrpxxrjxyhtxxdlxwnbxxjzxidfx
xpnxutjxxvbxgjnxxbpxszrxxhdxepvxyosyrgayyugydweyyauypmiyygiybcmy
ymwynsqyyskyziuyyemyxocyykayjegyyqoyvukyywcyhkoyycqytasyyieyfqwy
zptzshbzzvhzexfzzbvzqnjzzhjzcdnzznxzotrzztlzajvzzfnzypdzzlbzkfhz
zrpzwvlzzxdzilpzzdrzubtzzjfzgrxzaquaticaawiafygaacwarokaaikadeoa
aoyapusaaumabkwaagoazqeaamcalgiaasqaxwmaayeajmqaaesavcuaakgahsya

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: aquatica
Cipher: ndhngvpn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: aquatica
Cipher: 1114541144423111

Extended Methods:
Method #1

Plaintext: aquatica
method variations:
fvzfyohflaeldtnlqfkqiysqvlpvodxv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a q u a t i c a 
1 1 5 1 4 4 3 1 
1 4 4 1 4 2 1 1 
They are then read out in rows:
1151443114414211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: aquatica
Cipher: aetcqdia

Read more ...
Method #3

Plaintext: aquatica
method variations:
aydqtmaa ydqtmaaa dqtmaaay
qtmaaayd tmaaaydq maaaydqt
aaaydqtm aaydqtma

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: aquatica

first 5040 cipher variations(40320 total)
aquatica aquatiac aquatcia aquatcai aquataci aquataic aquaitca aquaitac aquaicta aquaicat aquaiact
aquaiatc aquacita aquaciat aquactia aquactai aquacati aquacait aquaaict aquaaitc aquaacit aquaacti
aquaatci aquaatic aqutaica aqutaiac aqutacia aqutacai aqutaaci aqutaaic aqutiaca aqutiaac aquticaa
aquticaa aqutiaca aqutiaac aqutciaa aqutciaa aqutcaia aqutcaai aqutcaai aqutcaia aqutaica aqutaiac
aqutacia aqutacai aqutaaci aqutaaic aquitaca aquitaac aquitcaa aquitcaa aquitaca aquitaac aquiatca
aquiatac aquiacta aquiacat aquiaact aquiaatc aquicata aquicaat aquictaa aquictaa aquicata aquicaat
aquiaact aquiaatc aquiacat aquiacta aquiatca aquiatac aquctiaa aquctiaa aquctaia aquctaai aquctaai
aquctaia aqucitaa aqucitaa aquciata aquciaat aquciaat aquciata aqucaita aqucaiat aqucatia aqucatai
aqucaati aqucaait aqucaiat aqucaita aqucaait aqucaati aqucatai aqucatia aquatica aquatiac aquatcia
aquatcai aquataci aquataic aquaitca aquaitac aquaicta aquaicat aquaiact aquaiatc aquacita aquaciat
aquactia aquactai aquacati aquacait aquaaict aquaaitc aquaacit aquaacti aquaatci aquaatic aqautica
aqautiac aqautcia aqautcai aqautaci aqautaic aqauitca aqauitac aqauicta aqauicat aqauiact aqauiatc
aqaucita aqauciat aqauctia aqauctai aqaucati aqaucait aqauaict aqauaitc aqauacit aqauacti aqauatci
aqauatic aqatuica aqatuiac aqatucia aqatucai aqatuaci aqatuaic aqatiuca aqatiuac aqaticua aqaticau
aqatiacu aqatiauc aqatciua aqatciau aqatcuia aqatcuai aqatcaui aqatcaiu aqataicu aqataiuc aqataciu
aqatacui aqatauci aqatauic aqaituca aqaituac aqaitcua aqaitcau aqaitacu aqaitauc aqaiutca aqaiutac
aqaiucta aqaiucat aqaiuact aqaiuatc aqaicuta aqaicuat aqaictua aqaictau aqaicatu aqaicaut aqaiauct
aqaiautc aqaiacut aqaiactu aqaiatcu aqaiatuc aqactiua aqactiau aqactuia aqactuai aqactaui aqactaiu
aqacitua aqacitau aqaciuta aqaciuat aqaciaut aqaciatu aqacuita aqacuiat aqacutia aqacutai aqacuati
aqacuait aqacaiut aqacaitu aqacauit aqacauti aqacatui aqacatiu aqaaticu aqaatiuc aqaatciu aqaatcui
aqaatuci aqaatuic aqaaitcu aqaaituc aqaaictu aqaaicut aqaaiuct aqaaiutc aqaacitu aqaaciut aqaactiu
aqaactui aqaacuti aqaacuit aqaauict aqaauitc aqaaucit aqaaucti aqaautci aqaautic aqtauica aqtauiac
aqtaucia aqtaucai aqtauaci aqtauaic aqtaiuca aqtaiuac aqtaicua aqtaicau aqtaiacu aqtaiauc aqtaciua
aqtaciau aqtacuia aqtacuai aqtacaui aqtacaiu aqtaaicu aqtaaiuc aqtaaciu aqtaacui aqtaauci aqtaauic
aqtuaica aqtuaiac aqtuacia aqtuacai aqtuaaci aqtuaaic aqtuiaca aqtuiaac aqtuicaa aqtuicaa aqtuiaca
aqtuiaac aqtuciaa aqtuciaa aqtucaia aqtucaai aqtucaai aqtucaia aqtuaica aqtuaiac aqtuacia aqtuacai
aqtuaaci aqtuaaic aqtiuaca aqtiuaac aqtiucaa aqtiucaa aqtiuaca aqtiuaac aqtiauca aqtiauac aqtiacua
aqtiacau aqtiaacu aqtiaauc aqticaua aqticaau aqticuaa aqticuaa aqticaua aqticaau aqtiaacu aqtiaauc
aqtiacau aqtiacua aqtiauca aqtiauac aqtcuiaa aqtcuiaa aqtcuaia aqtcuaai aqtcuaai aqtcuaia aqtciuaa
aqtciuaa aqtciaua aqtciaau aqtciaau aqtciaua aqtcaiua aqtcaiau aqtcauia aqtcauai aqtcaaui aqtcaaiu
aqtcaiau aqtcaiua aqtcaaiu aqtcaaui aqtcauai aqtcauia aqtauica aqtauiac aqtaucia aqtaucai aqtauaci
aqtauaic aqtaiuca aqtaiuac aqtaicua aqtaicau aqtaiacu aqtaiauc aqtaciua aqtaciau aqtacuia aqtacuai
aqtacaui aqtacaiu aqtaaicu aqtaaiuc aqtaaciu aqtaacui aqtaauci aqtaauic aqiatuca aqiatuac aqiatcua
aqiatcau aqiatacu aqiatauc aqiautca aqiautac aqiaucta aqiaucat aqiauact aqiauatc aqiacuta aqiacuat
aqiactua aqiactau aqiacatu aqiacaut aqiaauct aqiaautc aqiaacut aqiaactu aqiaatcu aqiaatuc aqitauca
aqitauac aqitacua aqitacau aqitaacu aqitaauc aqituaca aqituaac aqitucaa aqitucaa aqituaca aqituaac
aqitcuaa aqitcuaa aqitcaua aqitcaau aqitcaau aqitcaua aqitauca aqitauac aqitacua aqitacau aqitaacu
aqitaauc aqiutaca aqiutaac aqiutcaa aqiutcaa aqiutaca aqiutaac aqiuatca aqiuatac aqiuacta aqiuacat
aqiuaact aqiuaatc aqiucata aqiucaat aqiuctaa aqiuctaa aqiucata aqiucaat aqiuaact aqiuaatc aqiuacat
aqiuacta aqiuatca aqiuatac aqictuaa aqictuaa aqictaua aqictaau aqictaau aqictaua aqicutaa aqicutaa
aqicuata aqicuaat aqicuaat aqicuata aqicauta aqicauat aqicatua aqicatau aqicaatu aqicaaut aqicauat
aqicauta aqicaaut aqicaatu aqicatau aqicatua aqiatuca aqiatuac aqiatcua aqiatcau aqiatacu aqiatauc
aqiautca aqiautac aqiaucta aqiaucat aqiauact aqiauatc aqiacuta aqiacuat aqiactua aqiactau aqiacatu
aqiacaut aqiaauct aqiaautc aqiaacut aqiaactu aqiaatcu aqiaatuc aqcatiua aqcatiau aqcatuia aqcatuai
aqcataui aqcataiu aqcaitua aqcaitau aqcaiuta aqcaiuat aqcaiaut aqcaiatu aqcauita aqcauiat aqcautia
aqcautai aqcauati aqcauait aqcaaiut aqcaaitu aqcaauit aqcaauti aqcaatui aqcaatiu aqctaiua aqctaiau
aqctauia aqctauai aqctaaui aqctaaiu aqctiaua aqctiaau aqctiuaa aqctiuaa aqctiaua aqctiaau aqctuiaa
aqctuiaa aqctuaia aqctuaai aqctuaai aqctuaia aqctaiua aqctaiau aqctauia aqctauai aqctaaui aqctaaiu
aqcitaua aqcitaau aqcituaa aqcituaa aqcitaua aqcitaau aqciatua aqciatau aqciauta aqciauat aqciaaut
aqciaatu aqciuata aqciuaat aqciutaa aqciutaa aqciuata aqciuaat aqciaaut aqciaatu aqciauat aqciauta
aqciatua aqciatau aqcutiaa aqcutiaa aqcutaia aqcutaai aqcutaai aqcutaia aqcuitaa aqcuitaa aqcuiata
aqcuiaat aqcuiaat aqcuiata aqcuaita aqcuaiat aqcuatia aqcuatai aqcuaati aqcuaait aqcuaiat aqcuaita
aqcuaait aqcuaati aqcuatai aqcuatia aqcatiua aqcatiau aqcatuia aqcatuai aqcataui aqcataiu aqcaitua
aqcaitau aqcaiuta aqcaiuat aqcaiaut aqcaiatu aqcauita aqcauiat aqcautia aqcautai aqcauati aqcauait
aqcaaiut aqcaaitu aqcaauit aqcaauti aqcaatui aqcaatiu aqaaticu aqaatiuc aqaatciu aqaatcui aqaatuci
aqaatuic aqaaitcu aqaaituc aqaaictu aqaaicut aqaaiuct aqaaiutc aqaacitu aqaaciut aqaactiu aqaactui
aqaacuti aqaacuit aqaauict aqaauitc aqaaucit aqaaucti aqaautci aqaautic aqataicu aqataiuc aqataciu
aqatacui aqatauci aqatauic aqatiacu aqatiauc aqaticau aqaticua aqatiuca aqatiuac aqatciau aqatciua
aqatcaiu aqatcaui aqatcuai aqatcuia aqatuica aqatuiac aqatucia aqatucai aqatuaci aqatuaic aqaitacu
aqaitauc aqaitcau aqaitcua aqaituca aqaituac aqaiatcu aqaiatuc aqaiactu aqaiacut aqaiauct aqaiautc
aqaicatu aqaicaut aqaictau aqaictua aqaicuta aqaicuat aqaiuact aqaiuatc aqaiucat aqaiucta aqaiutca
aqaiutac aqactiau aqactiua aqactaiu aqactaui aqactuai aqactuia aqacitau aqacitua aqaciatu aqaciaut
aqaciuat aqaciuta aqacaitu aqacaiut aqacatiu aqacatui aqacauti aqacauit aqacuiat aqacuita aqacuait
aqacuati aqacutai aqacutia aqautica aqautiac aqautcia aqautcai aqautaci aqautaic aqauitca aqauitac
aqauicta aqauicat aqauiact aqauiatc aqaucita aqauciat aqauctia aqauctai aqaucati aqaucait aqauaict
aqauaitc aqauacit aqauacti aqauatci aqauatic auqatica auqatiac auqatcia auqatcai auqataci auqataic
auqaitca auqaitac auqaicta auqaicat auqaiact auqaiatc auqacita auqaciat auqactia auqactai auqacati
auqacait auqaaict auqaaitc auqaacit auqaacti auqaatci auqaatic auqtaica auqtaiac auqtacia auqtacai
auqtaaci auqtaaic auqtiaca auqtiaac auqticaa auqticaa auqtiaca auqtiaac auqtciaa auqtciaa auqtcaia
auqtcaai auqtcaai auqtcaia auqtaica auqtaiac auqtacia auqtacai auqtaaci auqtaaic auqitaca auqitaac
auqitcaa auqitcaa auqitaca auqitaac auqiatca auqiatac auqiacta auqiacat auqiaact auqiaatc auqicata
auqicaat auqictaa auqictaa auqicata auqicaat auqiaact auqiaatc auqiacat auqiacta auqiatca auqiatac
auqctiaa auqctiaa auqctaia auqctaai auqctaai auqctaia auqcitaa auqcitaa auqciata auqciaat auqciaat
auqciata auqcaita auqcaiat auqcatia auqcatai auqcaati auqcaait auqcaiat auqcaita auqcaait auqcaati
auqcatai auqcatia auqatica auqatiac auqatcia auqatcai auqataci auqataic auqaitca auqaitac auqaicta
auqaicat auqaiact auqaiatc auqacita auqaciat auqactia auqactai auqacati auqacait auqaaict auqaaitc
auqaacit auqaacti auqaatci auqaatic auaqtica auaqtiac auaqtcia auaqtcai auaqtaci auaqtaic auaqitca
auaqitac auaqicta auaqicat auaqiact auaqiatc auaqcita auaqciat auaqctia auaqctai auaqcati auaqcait
auaqaict auaqaitc auaqacit auaqacti auaqatci auaqatic auatqica auatqiac auatqcia auatqcai auatqaci
auatqaic auatiqca auatiqac auaticqa auaticaq auatiacq auatiaqc auatciqa auatciaq auatcqia auatcqai
auatcaqi auatcaiq auataicq auataiqc auataciq auatacqi auataqci auataqic auaitqca auaitqac auaitcqa
auaitcaq auaitacq auaitaqc auaiqtca auaiqtac auaiqcta auaiqcat auaiqact auaiqatc auaicqta auaicqat
auaictqa auaictaq auaicatq auaicaqt auaiaqct auaiaqtc auaiacqt auaiactq auaiatcq auaiatqc auactiqa
auactiaq auactqia auactqai auactaqi auactaiq auacitqa auacitaq auaciqta auaciqat auaciaqt auaciatq
auacqita auacqiat auacqtia auacqtai auacqati auacqait auacaiqt auacaitq auacaqit auacaqti auacatqi
auacatiq auaaticq auaatiqc auaatciq auaatcqi auaatqci auaatqic auaaitcq auaaitqc auaaictq auaaicqt
auaaiqct auaaiqtc auaacitq auaaciqt auaactiq auaactqi auaacqti auaacqit auaaqict auaaqitc auaaqcit
auaaqcti auaaqtci auaaqtic autaqica autaqiac autaqcia autaqcai autaqaci autaqaic autaiqca autaiqac
autaicqa autaicaq autaiacq autaiaqc autaciqa autaciaq autacqia autacqai autacaqi autacaiq autaaicq
autaaiqc autaaciq autaacqi autaaqci autaaqic autqaica autqaiac autqacia autqacai autqaaci autqaaic
autqiaca autqiaac autqicaa autqicaa autqiaca autqiaac autqciaa autqciaa autqcaia autqcaai autqcaai
autqcaia autqaica autqaiac autqacia autqacai autqaaci autqaaic autiqaca autiqaac autiqcaa autiqcaa
autiqaca autiqaac autiaqca autiaqac autiacqa autiacaq autiaacq autiaaqc auticaqa auticaaq auticqaa
auticqaa auticaqa auticaaq autiaacq autiaaqc autiacaq autiacqa autiaqca autiaqac autcqiaa autcqiaa
autcqaia autcqaai autcqaai autcqaia autciqaa autciqaa autciaqa autciaaq autciaaq autciaqa autcaiqa
autcaiaq autcaqia autcaqai autcaaqi autcaaiq autcaiaq autcaiqa autcaaiq autcaaqi autcaqai autcaqia
autaqica autaqiac autaqcia autaqcai autaqaci autaqaic autaiqca autaiqac autaicqa autaicaq autaiacq
autaiaqc autaciqa autaciaq autacqia autacqai autacaqi autacaiq autaaicq autaaiqc autaaciq autaacqi
autaaqci autaaqic auiatqca auiatqac auiatcqa auiatcaq auiatacq auiataqc auiaqtca auiaqtac auiaqcta
auiaqcat auiaqact auiaqatc auiacqta auiacqat auiactqa auiactaq auiacatq auiacaqt auiaaqct auiaaqtc
auiaacqt auiaactq auiaatcq auiaatqc auitaqca auitaqac auitacqa auitacaq auitaacq auitaaqc auitqaca
auitqaac auitqcaa auitqcaa auitqaca auitqaac auitcqaa auitcqaa auitcaqa auitcaaq auitcaaq auitcaqa
auitaqca auitaqac auitacqa auitacaq auitaacq auitaaqc auiqtaca auiqtaac auiqtcaa auiqtcaa auiqtaca
auiqtaac auiqatca auiqatac auiqacta auiqacat auiqaact auiqaatc auiqcata auiqcaat auiqctaa auiqctaa
auiqcata auiqcaat auiqaact auiqaatc auiqacat auiqacta auiqatca auiqatac auictqaa auictqaa auictaqa
auictaaq auictaaq auictaqa auicqtaa auicqtaa auicqata auicqaat auicqaat auicqata auicaqta auicaqat
auicatqa auicataq auicaatq auicaaqt auicaqat auicaqta auicaaqt auicaatq auicataq auicatqa auiatqca
auiatqac auiatcqa auiatcaq auiatacq auiataqc auiaqtca auiaqtac auiaqcta auiaqcat auiaqact auiaqatc
auiacqta auiacqat auiactqa auiactaq auiacatq auiacaqt auiaaqct auiaaqtc auiaacqt auiaactq auiaatcq
auiaatqc aucatiqa aucatiaq aucatqia aucatqai aucataqi aucataiq aucaitqa aucaitaq aucaiqta aucaiqat
aucaiaqt aucaiatq aucaqita aucaqiat aucaqtia aucaqtai aucaqati aucaqait aucaaiqt aucaaitq aucaaqit
aucaaqti aucaatqi aucaatiq auctaiqa auctaiaq auctaqia auctaqai auctaaqi auctaaiq auctiaqa auctiaaq
auctiqaa auctiqaa auctiaqa auctiaaq auctqiaa auctqiaa auctqaia auctqaai auctqaai auctqaia auctaiqa
auctaiaq auctaqia auctaqai auctaaqi auctaaiq aucitaqa aucitaaq aucitqaa aucitqaa aucitaqa aucitaaq
auciatqa auciataq auciaqta auciaqat auciaaqt auciaatq auciqata auciqaat auciqtaa auciqtaa auciqata
auciqaat auciaaqt auciaatq auciaqat auciaqta auciatqa auciataq aucqtiaa aucqtiaa aucqtaia aucqtaai
aucqtaai aucqtaia aucqitaa aucqitaa aucqiata aucqiaat aucqiaat aucqiata aucqaita aucqaiat aucqatia
aucqatai aucqaati aucqaait aucqaiat aucqaita aucqaait aucqaati aucqatai aucqatia aucatiqa aucatiaq
aucatqia aucatqai aucataqi aucataiq aucaitqa aucaitaq aucaiqta aucaiqat aucaiaqt aucaiatq aucaqita
aucaqiat aucaqtia aucaqtai aucaqati aucaqait aucaaiqt aucaaitq aucaaqit aucaaqti aucaatqi aucaatiq
auaaticq auaatiqc auaatciq auaatcqi auaatqci auaatqic auaaitcq auaaitqc auaaictq auaaicqt auaaiqct
auaaiqtc auaacitq auaaciqt auaactiq auaactqi auaacqti auaacqit auaaqict auaaqitc auaaqcit auaaqcti
auaaqtci auaaqtic auataicq auataiqc auataciq auatacqi auataqci auataqic auatiacq auatiaqc auaticaq
auaticqa auatiqca auatiqac auatciaq auatciqa auatcaiq auatcaqi auatcqai auatcqia auatqica auatqiac
auatqcia auatqcai auatqaci auatqaic auaitacq auaitaqc auaitcaq auaitcqa auaitqca auaitqac auaiatcq
auaiatqc auaiactq auaiacqt auaiaqct auaiaqtc auaicatq auaicaqt auaictaq auaictqa auaicqta auaicqat
auaiqact auaiqatc auaiqcat auaiqcta auaiqtca auaiqtac auactiaq auactiqa auactaiq auactaqi auactqai
auactqia auacitaq auacitqa auaciatq auaciaqt auaciqat auaciqta auacaitq auacaiqt auacatiq auacatqi
auacaqti auacaqit auacqiat auacqita auacqait auacqati auacqtai auacqtia auaqtica auaqtiac auaqtcia
auaqtcai auaqtaci auaqtaic auaqitca auaqitac auaqicta auaqicat auaqiact auaqiatc auaqcita auaqciat
auaqctia auaqctai auaqcati auaqcait auaqaict auaqaitc auaqacit auaqacti auaqatci auaqatic aauqtica
aauqtiac aauqtcia aauqtcai aauqtaci aauqtaic aauqitca aauqitac aauqicta aauqicat aauqiact aauqiatc
aauqcita aauqciat aauqctia aauqctai aauqcati aauqcait aauqaict aauqaitc aauqacit aauqacti aauqatci
aauqatic aautqica aautqiac aautqcia aautqcai aautqaci aautqaic aautiqca aautiqac aauticqa aauticaq
aautiacq aautiaqc aautciqa aautciaq aautcqia aautcqai aautcaqi aautcaiq aautaicq aautaiqc aautaciq
aautacqi aautaqci aautaqic aauitqca aauitqac aauitcqa aauitcaq aauitacq aauitaqc aauiqtca aauiqtac
aauiqcta aauiqcat aauiqact aauiqatc aauicqta aauicqat aauictqa aauictaq aauicatq aauicaqt aauiaqct
aauiaqtc aauiacqt aauiactq aauiatcq aauiatqc aauctiqa aauctiaq aauctqia aauctqai aauctaqi aauctaiq
aaucitqa aaucitaq aauciqta aauciqat aauciaqt aauciatq aaucqita aaucqiat aaucqtia aaucqtai aaucqati
aaucqait aaucaiqt aaucaitq aaucaqit aaucaqti aaucatqi aaucatiq aauaticq aauatiqc aauatciq aauatcqi
aauatqci aauatqic aauaitcq aauaitqc aauaictq aauaicqt aauaiqct aauaiqtc aauacitq aauaciqt aauactiq
aauactqi aauacqti aauacqit aauaqict aauaqitc aauaqcit aauaqcti aauaqtci aauaqtic aaqutica aaqutiac
aaqutcia aaqutcai aaqutaci aaqutaic aaquitca aaquitac aaquicta aaquicat aaquiact aaquiatc aaqucita
aaquciat aaquctia aaquctai aaqucati aaqucait aaquaict aaquaitc aaquacit aaquacti aaquatci aaquatic
aaqtuica aaqtuiac aaqtucia aaqtucai aaqtuaci aaqtuaic aaqtiuca aaqtiuac aaqticua aaqticau aaqtiacu
aaqtiauc aaqtciua aaqtciau aaqtcuia aaqtcuai aaqtcaui aaqtcaiu aaqtaicu aaqtaiuc aaqtaciu aaqtacui
aaqtauci aaqtauic aaqituca aaqituac aaqitcua aaqitcau aaqitacu aaqitauc aaqiutca aaqiutac aaqiucta
aaqiucat aaqiuact aaqiuatc aaqicuta aaqicuat aaqictua aaqictau aaqicatu aaqicaut aaqiauct aaqiautc
aaqiacut aaqiactu aaqiatcu aaqiatuc aaqctiua aaqctiau aaqctuia aaqctuai aaqctaui aaqctaiu aaqcitua
aaqcitau aaqciuta aaqciuat aaqciaut aaqciatu aaqcuita aaqcuiat aaqcutia aaqcutai aaqcuati aaqcuait
aaqcaiut aaqcaitu aaqcauit aaqcauti aaqcatui aaqcatiu aaqaticu aaqatiuc aaqatciu aaqatcui aaqatuci
aaqatuic aaqaitcu aaqaituc aaqaictu aaqaicut aaqaiuct aaqaiutc aaqacitu aaqaciut aaqactiu aaqactui
aaqacuti aaqacuit aaqauict aaqauitc aaqaucit aaqaucti aaqautci aaqautic aatquica aatquiac aatqucia
aatqucai aatquaci aatquaic aatqiuca aatqiuac aatqicua aatqicau aatqiacu aatqiauc aatqciua aatqciau
aatqcuia aatqcuai aatqcaui aatqcaiu aatqaicu aatqaiuc aatqaciu aatqacui aatqauci aatqauic aatuqica
aatuqiac aatuqcia aatuqcai aatuqaci aatuqaic aatuiqca aatuiqac aatuicqa aatuicaq aatuiacq aatuiaqc
aatuciqa aatuciaq aatucqia aatucqai aatucaqi aatucaiq aatuaicq aatuaiqc aatuaciq aatuacqi aatuaqci
aatuaqic aatiuqca aatiuqac aatiucqa aatiucaq aatiuacq aatiuaqc aatiquca aatiquac aatiqcua aatiqcau
aatiqacu aatiqauc aaticqua aaticqau aaticuqa aaticuaq aaticauq aaticaqu aatiaqcu aatiaquc aatiacqu
aatiacuq aatiaucq aatiauqc aatcuiqa aatcuiaq aatcuqia aatcuqai aatcuaqi aatcuaiq aatciuqa aatciuaq
aatciqua aatciqau aatciaqu aatciauq aatcqiua aatcqiau aatcquia aatcquai aatcqaui aatcqaiu aatcaiqu
aatcaiuq aatcaqiu aatcaqui aatcauqi aatcauiq aatauicq aatauiqc aatauciq aataucqi aatauqci aatauqic
aataiucq aataiuqc aataicuq aataicqu aataiqcu aataiquc aataciuq aataciqu aatacuiq aatacuqi aatacqui
aatacqiu aataqicu aataqiuc aataqciu aataqcui aataquci aataquic aaiqtuca aaiqtuac aaiqtcua aaiqtcau
aaiqtacu aaiqtauc aaiqutca aaiqutac aaiqucta aaiqucat aaiquact aaiquatc aaiqcuta aaiqcuat aaiqctua
aaiqctau aaiqcatu aaiqcaut aaiqauct aaiqautc aaiqacut aaiqactu aaiqatcu aaiqatuc aaitquca aaitquac
aaitqcua aaitqcau aaitqacu aaitqauc aaituqca aaituqac aaitucqa aaitucaq aaituacq aaituaqc aaitcuqa
aaitcuaq aaitcqua aaitcqau aaitcaqu aaitcauq aaitaucq aaitauqc aaitacuq aaitacqu aaitaqcu aaitaquc
aaiutqca aaiutqac aaiutcqa aaiutcaq aaiutacq aaiutaqc aaiuqtca aaiuqtac aaiuqcta aaiuqcat aaiuqact
aaiuqatc aaiucqta aaiucqat aaiuctqa aaiuctaq aaiucatq aaiucaqt aaiuaqct aaiuaqtc aaiuacqt aaiuactq
aaiuatcq aaiuatqc aaictuqa aaictuaq aaictqua aaictqau aaictaqu aaictauq aaicutqa aaicutaq aaicuqta
aaicuqat aaicuaqt aaicuatq aaicquta aaicquat aaicqtua aaicqtau aaicqatu aaicqaut aaicauqt aaicautq
aaicaqut aaicaqtu aaicatqu aaicatuq aaiatucq aaiatuqc aaiatcuq aaiatcqu aaiatqcu aaiatquc aaiautcq
aaiautqc aaiauctq aaiaucqt aaiauqct aaiauqtc aaiacutq aaiacuqt aaiactuq aaiactqu aaiacqtu aaiacqut
aaiaquct aaiaqutc aaiaqcut aaiaqctu aaiaqtcu aaiaqtuc aacqtiua aacqtiau aacqtuia aacqtuai aacqtaui
aacqtaiu aacqitua aacqitau aacqiuta aacqiuat aacqiaut aacqiatu aacquita aacquiat aacqutia aacqutai
aacquati aacquait aacqaiut aacqaitu aacqauit aacqauti aacqatui aacqatiu aactqiua aactqiau aactquia
aactquai aactqaui aactqaiu aactiqua aactiqau aactiuqa aactiuaq aactiauq aactiaqu aactuiqa aactuiaq
aactuqia aactuqai aactuaqi aactuaiq aactaiuq aactaiqu aactauiq aactauqi aactaqui aactaqiu aacitqua
aacitqau aacituqa aacituaq aacitauq aacitaqu aaciqtua aaciqtau aaciquta aaciquat aaciqaut aaciqatu
aaciuqta aaciuqat aaciutqa aaciutaq aaciuatq aaciuaqt aaciaqut aaciaqtu aaciauqt aaciautq aaciatuq
aaciatqu aacutiqa aacutiaq aacutqia aacutqai aacutaqi aacutaiq aacuitqa aacuitaq aacuiqta aacuiqat
aacuiaqt aacuiatq aacuqita aacuqiat aacuqtia aacuqtai aacuqati aacuqait aacuaiqt aacuaitq aacuaqit
aacuaqti aacuatqi aacuatiq aacatiuq aacatiqu aacatuiq aacatuqi aacatqui aacatqiu aacaituq aacaitqu
aacaiutq aacaiuqt aacaiqut aacaiqtu aacauitq aacauiqt aacautiq aacautqi aacauqti aacauqit aacaqiut
aacaqitu aacaquit aacaquti aacaqtui aacaqtiu aaaqticu aaaqtiuc aaaqtciu aaaqtcui aaaqtuci aaaqtuic
aaaqitcu aaaqituc aaaqictu aaaqicut aaaqiuct aaaqiutc aaaqcitu aaaqciut aaaqctiu aaaqctui aaaqcuti
aaaqcuit aaaquict aaaquitc aaaqucit aaaqucti aaaqutci aaaqutic aaatqicu aaatqiuc aaatqciu aaatqcui
aaatquci aaatquic aaatiqcu aaatiquc aaaticqu aaaticuq aaatiucq aaatiuqc aaatciqu aaatciuq aaatcqiu
aaatcqui aaatcuqi aaatcuiq aaatuicq aaatuiqc aaatuciq aaatucqi aaatuqci aaatuqic aaaitqcu aaaitquc
aaaitcqu aaaitcuq aaaitucq aaaituqc aaaiqtcu aaaiqtuc aaaiqctu aaaiqcut aaaiquct aaaiqutc aaaicqtu
aaaicqut aaaictqu aaaictuq aaaicutq aaaicuqt aaaiuqct aaaiuqtc aaaiucqt aaaiuctq aaaiutcq aaaiutqc
aaactiqu aaactiuq aaactqiu aaactqui aaactuqi aaactuiq aaacitqu aaacituq aaaciqtu aaaciqut aaaciuqt
aaaciutq aaacqitu aaacqiut aaacqtiu aaacqtui aaacquti aaacquit aaacuiqt aaacuitq aaacuqit aaacuqti
aaacutqi aaacutiq aaauticq aaautiqc aaautciq aaautcqi aaautqci aaautqic aaauitcq aaauitqc aaauictq
aaauicqt aaauiqct aaauiqtc aaaucitq aaauciqt aaauctiq aaauctqi aaaucqti aaaucqit aaauqict aaauqitc
aaauqcit aaauqcti aaauqtci aaauqtic atuaqica atuaqiac atuaqcia atuaqcai atuaqaci atuaqaic atuaiqca
atuaiqac atuaicqa atuaicaq atuaiacq atuaiaqc atuaciqa atuaciaq atuacqia atuacqai atuacaqi atuacaiq
atuaaicq atuaaiqc atuaaciq atuaacqi atuaaqci atuaaqic atuqaica atuqaiac atuqacia atuqacai atuqaaci
atuqaaic atuqiaca atuqiaac atuqicaa atuqicaa atuqiaca atuqiaac atuqciaa atuqciaa atuqcaia atuqcaai
atuqcaai atuqcaia atuqaica atuqaiac atuqacia atuqacai atuqaaci atuqaaic atuiqaca atuiqaac atuiqcaa
atuiqcaa atuiqaca atuiqaac atuiaqca atuiaqac atuiacqa atuiacaq atuiaacq atuiaaqc atuicaqa atuicaaq
atuicqaa atuicqaa atuicaqa atuicaaq atuiaacq atuiaaqc atuiacaq atuiacqa atuiaqca atuiaqac atucqiaa
atucqiaa atucqaia atucqaai atucqaai atucqaia atuciqaa atuciqaa atuciaqa atuciaaq atuciaaq atuciaqa
atucaiqa atucaiaq atucaqia atucaqai atucaaqi atucaaiq atucaiaq atucaiqa atucaaiq atucaaqi atucaqai
atucaqia atuaqica atuaqiac atuaqcia atuaqcai atuaqaci atuaqaic atuaiqca atuaiqac atuaicqa atuaicaq
atuaiacq atuaiaqc atuaciqa atuaciaq atuacqia atuacqai atuacaqi atuacaiq atuaaicq atuaaiqc atuaaciq
atuaacqi atuaaqci atuaaqic atauqica atauqiac atauqcia atauqcai atauqaci atauqaic atauiqca atauiqac
atauicqa atauicaq atauiacq atauiaqc atauciqa atauciaq ataucqia ataucqai ataucaqi ataucaiq atauaicq
atauaiqc atauaciq atauacqi atauaqci atauaqic ataquica ataquiac ataqucia ataqucai ataquaci ataquaic
ataqiuca ataqiuac ataqicua ataqicau ataqiacu ataqiauc ataqciua ataqciau ataqcuia ataqcuai ataqcaui
ataqcaiu ataqaicu ataqaiuc ataqaciu ataqacui ataqauci ataqauic ataiquca ataiquac ataiqcua ataiqcau
ataiqacu ataiqauc ataiuqca ataiuqac ataiucqa ataiucaq ataiuacq ataiuaqc ataicuqa ataicuaq ataicqua
ataicqau ataicaqu ataicauq ataiaucq ataiauqc ataiacuq ataiacqu ataiaqcu ataiaquc atacqiua atacqiau
atacquia atacquai atacqaui atacqaiu ataciqua ataciqau ataciuqa ataciuaq ataciauq ataciaqu atacuiqa
atacuiaq atacuqia atacuqai atacuaqi atacuaiq atacaiuq atacaiqu atacauiq atacauqi atacaqui atacaqiu
ataaqicu ataaqiuc ataaqciu ataaqcui ataaquci ataaquic ataaiqcu ataaiquc ataaicqu ataaicuq ataaiucq
ataaiuqc ataaciqu ataaciuq ataacqiu ataacqui ataacuqi ataacuiq ataauicq ataauiqc ataauciq ataaucqi
ataauqci ataauqic atqauica atqauiac atqaucia atqaucai atqauaci atqauaic atqaiuca atqaiuac atqaicua
atqaicau atqaiacu atqaiauc atqaciua atqaciau atqacuia atqacuai atqacaui atqacaiu atqaaicu atqaaiuc
atqaaciu atqaacui atqaauci atqaauic atquaica atquaiac atquacia atquacai atquaaci atquaaic atquiaca
atquiaac atquicaa atquicaa atquiaca atquiaac atquciaa atquciaa atqucaia atqucaai atqucaai atqucaia
atquaica atquaiac atquacia atquacai atquaaci atquaaic atqiuaca atqiuaac atqiucaa atqiucaa atqiuaca
atqiuaac atqiauca atqiauac atqiacua atqiacau atqiaacu atqiaauc atqicaua atqicaau atqicuaa atqicuaa
atqicaua atqicaau atqiaacu atqiaauc atqiacau atqiacua atqiauca atqiauac atqcuiaa atqcuiaa atqcuaia
atqcuaai atqcuaai atqcuaia atqciuaa atqciuaa atqciaua atqciaau atqciaau atqciaua atqcaiua atqcaiau
atqcauia atqcauai atqcaaui atqcaaiu atqcaiau atqcaiua atqcaaiu atqcaaui atqcauai atqcauia atqauica
atqauiac atqaucia atqaucai atqauaci atqauaic atqaiuca atqaiuac atqaicua atqaicau atqaiacu atqaiauc
atqaciua atqaciau atqacuia atqacuai atqacaui atqacaiu atqaaicu atqaaiuc atqaaciu atqaacui atqaauci
atqaauic atiaquca atiaquac atiaqcua atiaqcau atiaqacu atiaqauc atiauqca atiauqac atiaucqa atiaucaq
atiauacq atiauaqc atiacuqa atiacuaq atiacqua atiacqau atiacaqu atiacauq atiaaucq atiaauqc atiaacuq
atiaacqu atiaaqcu atiaaquc atiqauca atiqauac atiqacua atiqacau atiqaacu atiqaauc atiquaca atiquaac
atiqucaa atiqucaa atiquaca atiquaac atiqcuaa atiqcuaa atiqcaua atiqcaau atiqcaau atiqcaua atiqauca
atiqauac atiqacua atiqacau atiqaacu atiqaauc atiuqaca atiuqaac atiuqcaa atiuqcaa atiuqaca atiuqaac
atiuaqca atiuaqac atiuacqa atiuacaq atiuaacq atiuaaqc atiucaqa atiucaaq atiucqaa atiucqaa atiucaqa
atiucaaq atiuaacq atiuaaqc atiuacaq atiuacqa atiuaqca atiuaqac aticquaa aticquaa aticqaua aticqaau
aticqaau aticqaua aticuqaa aticuqaa aticuaqa aticuaaq aticuaaq aticuaqa aticauqa aticauaq aticaqua
aticaqau aticaaqu aticaauq aticauaq aticauqa aticaauq aticaaqu aticaqau aticaqua atiaquca atiaquac
atiaqcua atiaqcau atiaqacu atiaqauc atiauqca atiauqac atiaucqa atiaucaq atiauacq atiauaqc atiacuqa
atiacuaq atiacqua atiacqau atiacaqu atiacauq atiaaucq atiaauqc atiaacuq atiaacqu atiaaqcu atiaaquc
atcaqiua atcaqiau atcaquia atcaquai atcaqaui atcaqaiu atcaiqua atcaiqau atcaiuqa atcaiuaq atcaiauq
atcaiaqu atcauiqa atcauiaq atcauqia atcauqai atcauaqi atcauaiq atcaaiuq atcaaiqu atcaauiq atcaauqi
atcaaqui atcaaqiu atcqaiua atcqaiau atcqauia atcqauai atcqaaui atcqaaiu atcqiaua atcqiaau atcqiuaa
atcqiuaa atcqiaua atcqiaau atcquiaa atcquiaa atcquaia atcquaai atcquaai atcquaia atcqaiua atcqaiau
atcqauia atcqauai atcqaaui atcqaaiu atciqaua atciqaau atciquaa atciquaa atciqaua atciqaau atciaqua
atciaqau atciauqa atciauaq atciaauq atciaaqu atciuaqa atciuaaq atciuqaa atciuqaa atciuaqa atciuaaq
atciaauq atciaaqu atciauaq atciauqa atciaqua atciaqau atcuqiaa atcuqiaa atcuqaia atcuqaai atcuqaai
atcuqaia atcuiqaa atcuiqaa atcuiaqa atcuiaaq atcuiaaq atcuiaqa atcuaiqa atcuaiaq atcuaqia atcuaqai
atcuaaqi atcuaaiq atcuaiaq atcuaiqa atcuaaiq atcuaaqi atcuaqai atcuaqia atcaqiua atcaqiau atcaquia
atcaquai atcaqaui atcaqaiu atcaiqua atcaiqau atcaiuqa atcaiuaq atcaiauq atcaiaqu atcauiqa atcauiaq
atcauqia atcauqai atcauaqi atcauaiq atcaaiuq atcaaiqu atcaauiq atcaauqi atcaaqui atcaaqiu ataaqicu
ataaqiuc ataaqciu ataaqcui ataaquci ataaquic ataaiqcu ataaiquc ataaicqu ataaicuq ataaiucq ataaiuqc
ataaciqu ataaciuq ataacqiu ataacqui ataacuqi ataacuiq ataauicq ataauiqc ataauciq ataaucqi ataauqci
ataauqic ataqaicu ataqaiuc ataqaciu ataqacui ataqauci ataqauic ataqiacu ataqiauc ataqicau ataqicua
ataqiuca ataqiuac ataqciau ataqciua ataqcaiu ataqcaui ataqcuai ataqcuia ataquica ataquiac ataqucia
ataqucai ataquaci ataquaic ataiqacu ataiqauc ataiqcau ataiqcua ataiquca ataiquac ataiaqcu ataiaquc
ataiacqu ataiacuq ataiaucq ataiauqc ataicaqu ataicauq ataicqau ataicqua ataicuqa ataicuaq ataiuacq
ataiuaqc ataiucaq ataiucqa ataiuqca ataiuqac atacqiau atacqiua atacqaiu atacqaui atacquai atacquia
ataciqau ataciqua ataciaqu ataciauq ataciuaq ataciuqa atacaiqu atacaiuq atacaqiu atacaqui atacauqi
atacauiq atacuiaq atacuiqa atacuaiq atacuaqi atacuqai atacuqia atauqica atauqiac atauqcia atauqcai
atauqaci atauqaic atauiqca atauiqac atauicqa atauicaq atauiacq atauiaqc atauciqa atauciaq ataucqia
ataucqai ataucaqi ataucaiq atauaicq atauaiqc atauaciq atauacqi atauaqci atauaqic aiuatqca aiuatqac
aiuatcqa aiuatcaq aiuatacq aiuataqc aiuaqtca aiuaqtac aiuaqcta aiuaqcat aiuaqact aiuaqatc aiuacqta
aiuacqat aiuactqa aiuactaq aiuacatq aiuacaqt aiuaaqct aiuaaqtc aiuaacqt aiuaactq aiuaatcq aiuaatqc
aiutaqca aiutaqac aiutacqa aiutacaq aiutaacq aiutaaqc aiutqaca aiutqaac aiutqcaa aiutqcaa aiutqaca
aiutqaac aiutcqaa aiutcqaa aiutcaqa aiutcaaq aiutcaaq aiutcaqa aiutaqca aiutaqac aiutacqa aiutacaq
aiutaacq aiutaaqc aiuqtaca aiuqtaac aiuqtcaa aiuqtcaa aiuqtaca aiuqtaac aiuqatca aiuqatac aiuqacta
aiuqacat aiuqaact aiuqaatc aiuqcata aiuqcaat aiuqctaa aiuqctaa aiuqcata aiuqcaat aiuqaact aiuqaatc
aiuqacat aiuqacta aiuqatca aiuqatac aiuctqaa aiuctqaa aiuctaqa aiuctaaq aiuctaaq aiuctaqa aiucqtaa
aiucqtaa aiucqata aiucqaat aiucqaat aiucqata aiucaqta aiucaqat aiucatqa aiucataq aiucaatq aiucaaqt
aiucaqat aiucaqta aiucaaqt aiucaatq aiucataq aiucatqa aiuatqca aiuatqac aiuatcqa aiuatcaq aiuatacq
aiuataqc aiuaqtca aiuaqtac aiuaqcta aiuaqcat aiuaqact aiuaqatc aiuacqta aiuacqat aiuactqa aiuactaq
aiuacatq aiuacaqt aiuaaqct aiuaaqtc aiuaacqt aiuaactq aiuaatcq aiuaatqc aiautqca aiautqac aiautcqa
aiautcaq aiautacq aiautaqc aiauqtca aiauqtac aiauqcta aiauqcat aiauqact aiauqatc aiaucqta aiaucqat
aiauctqa aiauctaq aiaucatq aiaucaqt aiauaqct aiauaqtc aiauacqt aiauactq aiauatcq aiauatqc aiatuqca
aiatuqac aiatucqa aiatucaq aiatuacq aiatuaqc aiatquca aiatquac aiatqcua aiatqcau aiatqacu aiatqauc
aiatcqua aiatcqau aiatcuqa aiatcuaq aiatcauq aiatcaqu aiataqcu aiataquc aiatacqu aiatacuq aiataucq
aiatauqc aiaqtuca aiaqtuac aiaqtcua aiaqtcau aiaqtacu aiaqtauc aiaqutca aiaqutac aiaqucta aiaqucat
aiaquact aiaquatc aiaqcuta aiaqcuat aiaqctua aiaqctau aiaqcatu aiaqcaut aiaqauct aiaqautc aiaqacut
aiaqactu aiaqatcu aiaqatuc aiactqua aiactqau aiactuqa aiactuaq aiactauq aiactaqu aiacqtua aiacqtau
aiacquta aiacquat aiacqaut aiacqatu aiacuqta aiacuqat aiacutqa aiacutaq aiacuatq aiacuaqt aiacaqut
aiacaqtu aiacauqt aiacautq aiacatuq aiacatqu aiaatqcu aiaatquc aiaatcqu aiaatcuq aiaatucq aiaatuqc
aiaaqtcu aiaaqtuc aiaaqctu aiaaqcut aiaaquct aiaaqutc aiaacqtu aiaacqut aiaactqu aiaactuq aiaacutq
aiaacuqt aiaauqct aiaauqtc aiaaucqt aiaauctq aiaautcq aiaautqc aitauqca aitauqac aitaucqa aitaucaq
aitauacq aitauaqc aitaquca aitaquac aitaqcua aitaqcau aitaqacu aitaqauc aitacqua aitacqau aitacuqa
aitacuaq aitacauq aitacaqu aitaaqcu aitaaquc aitaacqu aitaacuq aitaaucq aitaauqc aituaqca aituaqac
aituacqa aituacaq aituaacq aituaaqc aituqaca aituqaac aituqcaa aituqcaa aituqaca aituqaac aitucqaa
aitucqaa aitucaqa aitucaaq aitucaaq aitucaqa aituaqca aituaqac aituacqa aituacaq aituaacq aituaaqc
aitquaca aitquaac aitqucaa aitqucaa aitquaca aitquaac aitqauca aitqauac aitqacua aitqacau aitqaacu
aitqaauc aitqcaua aitqcaau aitqcuaa aitqcuaa aitqcaua aitqcaau aitqaacu aitqaauc aitqacau aitqacua
aitqauca aitqauac aitcuqaa aitcuqaa aitcuaqa aitcuaaq aitcuaaq aitcuaqa aitcquaa aitcquaa aitcqaua
aitcqaau aitcqaau aitcqaua aitcaqua aitcaqau aitcauqa aitcauaq aitcaauq aitcaaqu aitcaqau aitcaqua
aitcaaqu aitcaauq aitcauaq aitcauqa aitauqca aitauqac aitaucqa aitaucaq aitauacq aitauaqc aitaquca
aitaquac aitaqcua aitaqcau aitaqacu aitaqauc aitacqua aitacqau aitacuqa aitacuaq aitacauq aitacaqu
aitaaqcu aitaaquc aitaacqu aitaacuq aitaaucq aitaauqc aiqatuca aiqatuac aiqatcua aiqatcau aiqatacu
aiqatauc aiqautca aiqautac aiqaucta aiqaucat aiqauact aiqauatc aiqacuta aiqacuat aiqactua aiqactau
aiqacatu aiqacaut aiqaauct aiqaautc aiqaacut aiqaactu aiqaatcu aiqaatuc aiqtauca aiqtauac aiqtacua
aiqtacau aiqtaacu aiqtaauc aiqtuaca aiqtuaac aiqtucaa aiqtucaa aiqtuaca aiqtuaac aiqtcuaa aiqtcuaa
aiqtcaua aiqtcaau aiqtcaau aiqtcaua aiqtauca aiqtauac aiqtacua aiqtacau aiqtaacu aiqtaauc aiqutaca
aiqutaac aiqutcaa aiqutcaa aiqutaca aiqutaac aiquatca aiquatac aiquacta aiquacat aiquaact aiquaatc
aiqucata aiqucaat aiquctaa aiquctaa aiqucata aiqucaat aiquaact aiquaatc aiquacat aiquacta aiquatca
aiquatac aiqctuaa aiqctuaa aiqctaua aiqctaau aiqctaau aiqctaua aiqcutaa aiqcutaa aiqcuata aiqcuaat
aiqcuaat aiqcuata aiqcauta aiqcauat aiqcatua aiqcatau aiqcaatu aiqcaaut aiqcauat aiqcauta aiqcaaut
aiqcaatu aiqcatau aiqcatua aiqatuca aiqatuac aiqatcua aiqatcau aiqatacu aiqatauc aiqautca aiqautac
aiqaucta aiqaucat aiqauact aiqauatc aiqacuta aiqacuat aiqactua aiqactau aiqacatu aiqacaut aiqaauct
aiqaautc aiqaacut aiqaactu aiqaatcu aiqaatuc aicatqua aicatqau aicatuqa aicatuaq aicatauq aicataqu
aicaqtua aicaqtau aicaquta aicaquat aicaqaut aicaqatu aicauqta aicauqat aicautqa aicautaq aicauatq
aicauaqt aicaaqut aicaaqtu aicaauqt aicaautq aicaatuq aicaatqu aictaqua aictaqau aictauqa aictauaq
aictaauq aictaaqu aictqaua aictqaau aictquaa aictquaa aictqaua aictqaau aictuqaa aictuqaa aictuaqa
aictuaaq aictuaaq aictuaqa aictaqua aictaqau aictauqa aictauaq aictaauq aictaaqu aicqtaua aicqtaau
aicqtuaa aicqtuaa aicqtaua aicqtaau aicqatua aicqatau aicqauta aicqauat aicqaaut aicqaatu aicquata
aicquaat aicqutaa aicqutaa aicquata aicquaat aicqaaut aicqaatu aicqauat aicqauta aicqatua aicqatau
aicutqaa aicutqaa aicutaqa aicutaaq aicutaaq aicutaqa aicuqtaa aicuqtaa aicuqata aicuqaat aicuqaat
aicuqata aicuaqta aicuaqat aicuatqa aicuataq aicuaatq aicuaaqt aicuaqat aicuaqta aicuaaqt aicuaatq
aicuataq aicuatqa aicatqua aicatqau aicatuqa aicatuaq aicatauq aicataqu aicaqtua aicaqtau aicaquta
aicaquat aicaqaut aicaqatu aicauqta aicauqat aicautqa aicautaq aicauatq aicauaqt aicaaqut aicaaqtu
aicaauqt aicaautq aicaatuq aicaatqu aiaatqcu aiaatquc aiaatcqu aiaatcuq aiaatucq aiaatuqc aiaaqtcu
aiaaqtuc aiaaqctu aiaaqcut aiaaquct aiaaqutc aiaacqtu aiaacqut aiaactqu aiaactuq aiaacutq aiaacuqt
aiaauqct aiaauqtc aiaaucqt aiaauctq aiaautcq aiaautqc aiataqcu aiataquc aiatacqu aiatacuq aiataucq
aiatauqc aiatqacu aiatqauc aiatqcau aiatqcua aiatquca aiatquac aiatcqau aiatcqua aiatcaqu aiatcauq
aiatcuaq aiatcuqa aiatuqca aiatuqac aiatucqa aiatucaq aiatuacq aiatuaqc aiaqtacu aiaqtauc aiaqtcau
aiaqtcua aiaqtuca aiaqtuac aiaqatcu aiaqatuc aiaqactu aiaqacut aiaqauct aiaqautc aiaqcatu aiaqcaut
aiaqctau aiaqctua aiaqcuta aiaqcuat aiaquact aiaquatc aiaqucat aiaqucta aiaqutca aiaqutac aiactqau
aiactqua aiactaqu aiactauq aiactuaq aiactuqa aiacqtau aiacqtua aiacqatu aiacqaut aiacquat aiacquta
aiacaqtu aiacaqut aiacatqu aiacatuq aiacautq aiacauqt aiacuqat aiacuqta aiacuaqt aiacuatq aiacutaq
aiacutqa aiautqca aiautqac aiautcqa aiautcaq aiautacq aiautaqc aiauqtca aiauqtac aiauqcta aiauqcat
aiauqact aiauqatc aiaucqta aiaucqat aiauctqa aiauctaq aiaucatq aiaucaqt aiauaqct aiauaqtc aiauacqt
aiauactq aiauatcq aiauatqc acuatiqa acuatiaq acuatqia acuatqai acuataqi acuataiq acuaitqa acuaitaq
acuaiqta acuaiqat acuaiaqt acuaiatq acuaqita acuaqiat acuaqtia acuaqtai acuaqati acuaqait acuaaiqt
acuaaitq acuaaqit acuaaqti acuaatqi acuaatiq acutaiqa acutaiaq acutaqia acutaqai acutaaqi acutaaiq
acutiaqa acutiaaq acutiqaa acutiqaa acutiaqa acutiaaq acutqiaa acutqiaa acutqaia acutqaai acutqaai
acutqaia acutaiqa acutaiaq acutaqia acutaqai acutaaqi acutaaiq acuitaqa acuitaaq acuitqaa acuitqaa
acuitaqa acuitaaq acuiatqa acuiataq acuiaqta acuiaqat acuiaaqt acuiaatq acuiqata acuiqaat acuiqtaa
acuiqtaa acuiqata acuiqaat acuiaaqt acuiaatq acuiaqat acuiaqta acuiatqa acuiataq acuqtiaa acuqtiaa
acuqtaia acuqtaai acuqtaai acuqtaia acuqitaa acuqitaa acuqiata acuqiaat acuqiaat acuqiata acuqaita
acuqaiat acuqatia acuqatai acuqaati acuqaait acuqaiat acuqaita acuqaait acuqaati acuqatai acuqatia
acuatiqa acuatiaq acuatqia acuatqai acuataqi acuataiq acuaitqa acuaitaq acuaiqta acuaiqat acuaiaqt
acuaiatq acuaqita acuaqiat acuaqtia acuaqtai acuaqati acuaqait acuaaiqt acuaaitq acuaaqit acuaaqti
acuaatqi acuaatiq acautiqa acautiaq acautqia acautqai acautaqi acautaiq acauitqa acauitaq acauiqta
acauiqat acauiaqt acauiatq acauqita acauqiat acauqtia acauqtai acauqati acauqait acauaiqt acauaitq
acauaqit acauaqti acauatqi acauatiq acatuiqa acatuiaq acatuqia acatuqai acatuaqi acatuaiq acatiuqa
acatiuaq acatiqua acatiqau acatiaqu acatiauq acatqiua acatqiau acatquia acatquai acatqaui acatqaiu
acataiqu acataiuq acataqiu acataqui acatauqi acatauiq acaituqa acaituaq acaitqua acaitqau acaitaqu
acaitauq acaiutqa acaiutaq acaiuqta acaiuqat acaiuaqt acaiuatq acaiquta acaiquat acaiqtua acaiqtau
acaiqatu acaiqaut acaiauqt acaiautq acaiaqut acaiaqtu acaiatqu acaiatuq acaqtiua acaqtiau acaqtuia
acaqtuai acaqtaui acaqtaiu acaqitua acaqitau acaqiuta acaqiuat acaqiaut acaqiatu acaquita acaquiat
acaqutia acaqutai acaquati acaquait acaqaiut acaqaitu acaqauit acaqauti acaqatui acaqatiu acaatiqu
acaatiuq acaatqiu acaatqui acaatuqi acaatuiq acaaitqu acaaituq acaaiqtu acaaiqut acaaiuqt acaaiutq
acaaqitu acaaqiut acaaqtiu acaaqtui acaaquti acaaquit acaauiqt acaauitq acaauqit acaauqti acaautqi
acaautiq actauiqa actauiaq actauqia actauqai actauaqi actauaiq actaiuqa actaiuaq actaiqua actaiqau
actaiaqu actaiauq actaqiua actaqiau actaquia actaquai actaqaui actaqaiu actaaiqu actaaiuq actaaqiu
actaaqui actaauqi actaauiq actuaiqa actuaiaq actuaqia actuaqai actuaaqi actuaaiq actuiaqa actuiaaq
actuiqaa actuiqaa actuiaqa actuiaaq actuqiaa actuqiaa actuqaia actuqaai actuqaai actuqaia actuaiqa
actuaiaq actuaqia actuaqai actuaaqi actuaaiq actiuaqa actiuaaq actiuqaa actiuqaa actiuaqa actiuaaq
actiauqa actiauaq actiaqua actiaqau actiaaqu actiaauq actiqaua actiqaau actiquaa actiquaa actiqaua
actiqaau actiaaqu actiaauq actiaqau actiaqua actiauqa actiauaq actquiaa actquiaa actquaia actquaai
actquaai actquaia actqiuaa actqiuaa actqiaua actqiaau actqiaau actqiaua actqaiua actqaiau actqauia
actqauai actqaaui actqaaiu actqaiau actqaiua actqaaiu actqaaui actqauai actqauia actauiqa actauiaq
actauqia actauqai actauaqi actauaiq actaiuqa actaiuaq actaiqua actaiqau actaiaqu actaiauq actaqiua
actaqiau actaquia actaquai actaqaui actaqaiu actaaiqu actaaiuq actaaqiu actaaqui actaauqi actaauiq
aciatuqa aciatuaq aciatqua aciatqau aciataqu aciatauq aciautqa aciautaq aciauqta aciauqat aciauaqt
aciauatq aciaquta aciaquat aciaqtua aciaqtau aciaqatu aciaqaut aciaauqt aciaautq aciaaqut aciaaqtu
aciaatqu aciaatuq acitauqa acitauaq acitaqua acitaqau acitaaqu acitaauq acituaqa acituaaq acituqaa
acituqaa acituaqa acituaaq acitquaa acitquaa acitqaua acitqaau acitqaau acitqaua acitauqa acitauaq
acitaqua acitaqau acitaaqu acitaauq aciutaqa aciutaaq aciutqaa aciutqaa aciutaqa aciutaaq aciuatqa
aciuataq aciuaqta aciuaqat aciuaaqt aciuaatq aciuqata aciuqaat aciuqtaa aciuqtaa aciuqata aciuqaat
aciuaaqt aciuaatq aciuaqat aciuaqta aciuatqa aciuataq aciqtuaa aciqtuaa aciqtaua aciqtaau aciqtaau
aciqtaua aciqutaa aciqutaa aciquata aciquaat aciquaat aciquata aciqauta aciqauat aciqatua aciqatau
aciqaatu aciqaaut aciqauat aciqauta aciqaaut aciqaatu aciqatau aciqatua aciatuqa aciatuaq aciatqua
aciatqau aciataqu aciatauq aciautqa aciautaq aciauqta aciauqat aciauaqt aciauatq aciaquta aciaquat
aciaqtua aciaqtau aciaqatu aciaqaut aciaauqt aciaautq aciaaqut aciaaqtu aciaatqu aciaatuq acqatiua
acqatiau acqatuia acqatuai acqataui acqataiu acqaitua acqaitau acqaiuta acqaiuat acqaiaut acqaiatu
acqauita acqauiat acqautia acqautai acqauati acqauait acqaaiut acqaaitu acqaauit acqaauti acqaatui
acqaatiu acqtaiua acqtaiau acqtauia acqtauai acqtaaui acqtaaiu acqtiaua acqtiaau acqtiuaa acqtiuaa
acqtiaua acqtiaau acqtuiaa acqtuiaa acqtuaia acqtuaai acqtuaai acqtuaia acqtaiua acqtaiau acqtauia
acqtauai acqtaaui acqtaaiu acqitaua acqitaau acqituaa acqituaa acqitaua acqitaau acqiatua acqiatau
acqiauta acqiauat acqiaaut acqiaatu acqiuata acqiuaat acqiutaa acqiutaa acqiuata acqiuaat acqiaaut
acqiaatu acqiauat acqiauta acqiatua acqiatau acqutiaa acqutiaa acqutaia acqutaai acqutaai acqutaia
acquitaa acquitaa acquiata acquiaat acquiaat acquiata acquaita acquaiat acquatia acquatai acquaati
acquaait acquaiat acquaita acquaait acquaati acquatai acquatia acqatiua acqatiau acqatuia acqatuai
acqataui acqataiu acqaitua acqaitau acqaiuta acqaiuat acqaiaut acqaiatu acqauita acqauiat acqautia
acqautai acqauati acqauait acqaaiut acqaaitu acqaauit acqaauti acqaatui acqaatiu acaatiqu acaatiuq
acaatqiu acaatqui acaatuqi acaatuiq acaaitqu acaaituq acaaiqtu acaaiqut acaaiuqt acaaiutq acaaqitu
acaaqiut acaaqtiu acaaqtui acaaquti acaaquit acaauiqt acaauitq acaauqit acaauqti acaautqi acaautiq
acataiqu acataiuq acataqiu acataqui acatauqi acatauiq acatiaqu acatiauq acatiqau acatiqua acatiuqa
acatiuaq acatqiau acatqiua acatqaiu acatqaui acatquai acatquia acatuiqa acatuiaq acatuqia acatuqai
acatuaqi acatuaiq acaitaqu acaitauq acaitqau acaitqua acaituqa acaituaq acaiatqu acaiatuq acaiaqtu
acaiaqut acaiauqt acaiautq acaiqatu acaiqaut acaiqtau acaiqtua acaiquta acaiquat acaiuaqt acaiuatq
acaiuqat acaiuqta acaiutqa acaiutaq acaqtiau acaqtiua acaqtaiu acaqtaui acaqtuai acaqtuia acaqitau
acaqitua acaqiatu acaqiaut acaqiuat acaqiuta acaqaitu acaqaiut acaqatiu acaqatui acaqauti acaqauit
acaquiat acaquita acaquait acaquati acaqutai acaqutia acautiqa acautiaq acautqia acautqai acautaqi
acautaiq acauitqa acauitaq acauiqta acauiqat acauiaqt acauiatq acauqita acauqiat acauqtia acauqtai
acauqati acauqait acauaiqt acauaitq acauaqit acauaqti acauatqi acauatiq aauaticq aauatiqc aauatciq
aauatcqi aauatqci aauatqic aauaitcq aauaitqc aauaictq aauaicqt aauaiqct aauaiqtc aauacitq aauaciqt
aauactiq aauactqi aauacqti aauacqit aauaqict aauaqitc aauaqcit aauaqcti aauaqtci aauaqtic aautaicq
aautaiqc aautaciq aautacqi aautaqci aautaqic aautiacq aautiaqc aauticaq aauticqa aautiqca aautiqac
aautciaq aautciqa aautcaiq aautcaqi aautcqai aautcqia aautqica aautqiac aautqcia aautqcai aautqaci
aautqaic aauitacq aauitaqc aauitcaq aauitcqa aauitqca aauitqac aauiatcq aauiatqc aauiactq aauiacqt
aauiaqct aauiaqtc aauicatq aauicaqt aauictaq aauictqa aauicqta aauicqat aauiqact aauiqatc aauiqcat
aauiqcta aauiqtca aauiqtac aauctiaq aauctiqa aauctaiq aauctaqi aauctqai aauctqia aaucitaq aaucitqa
aauciatq aauciaqt aauciqat aauciqta aaucaitq aaucaiqt aaucatiq aaucatqi aaucaqti aaucaqit aaucqiat
aaucqita aaucqait aaucqati aaucqtai aaucqtia aauqtica aauqtiac aauqtcia aauqtcai aauqtaci aauqtaic
aauqitca aauqitac aauqicta aauqicat aauqiact aauqiatc aauqcita aauqciat aauqctia aauqctai aauqcati
aauqcait aauqaict aauqaitc aauqacit aauqacti aauqatci aauqatic aaauticq aaautiqc aaautciq aaautcqi
aaautqci aaautqic aaauitcq aaauitqc aaauictq aaauicqt aaauiqct aaauiqtc aaaucitq aaauciqt aaauctiq
aaauctqi aaaucqti aaaucqit aaauqict aaauqitc aaauqcit aaauqcti aaauqtci aaauqtic aaatuicq aaatuiqc
aaatuciq aaatucqi aaatuqci aaatuqic aaatiucq aaatiuqc aaaticuq aaaticqu aaatiqcu aaatiquc aaatciuq
aaatciqu aaatcuiq aaatcuqi aaatcqui aaatcqiu aaatqicu aaatqiuc aaatqciu aaatqcui aaatquci aaatquic
aaaitucq aaaituqc aaaitcuq aaaitcqu aaaitqcu aaaitquc aaaiutcq aaaiutqc aaaiuctq aaaiucqt aaaiuqct
aaaiuqtc aaaicutq aaaicuqt aaaictuq aaaictqu aaaicqtu aaaicqut aaaiquct aaaiqutc aaaiqcut aaaiqctu
aaaiqtcu aaaiqtuc aaactiuq aaactiqu aaactuiq aaactuqi aaactqui aaactqiu aaacituq aaacitqu aaaciutq
aaaciuqt aaaciqut aaaciqtu aaacuitq aaacuiqt aaacutiq aaacutqi aaacuqti aaacuqit aaacqiut aaacqitu
aaacquit aaacquti aaacqtui aaacqtiu aaaqticu aaaqtiuc aaaqtciu aaaqtcui aaaqtuci aaaqtuic aaaqitcu
aaaqituc aaaqictu aaaqicut aaaqiuct aaaqiutc aaaqcitu aaaqciut aaaqctiu aaaqctui aaaqcuti aaaqcuit
aaaquict aaaquitc aaaqucit aaaqucti aaaqutci aaaqutic aatauicq aatauiqc aatauciq aataucqi aatauqci
aatauqic aataiucq aataiuqc aataicuq aataicqu aataiqcu aataiquc aataciuq aataciqu aatacuiq aatacuqi
aatacqui aatacqiu aataqicu aataqiuc aataqciu aataqcui aataquci aataquic aatuaicq aatuaiqc aatuaciq
aatuacqi aatuaqci aatuaqic aatuiacq aatuiaqc aatuicaq aatuicqa aatuiqca aatuiqac aatuciaq aatuciqa
aatucaiq aatucaqi aatucqai aatucqia aatuqica aatuqiac aatuqcia aatuqcai aatuqaci aatuqaic aatiuacq
aatiuaqc aatiucaq aatiucqa aatiuqca aatiuqac aatiaucq aatiauqc aatiacuq aatiacqu aatiaqcu aatiaquc
aaticauq aaticaqu aaticuaq aaticuqa aaticqua aaticqau aatiqacu aatiqauc aatiqcau aatiqcua aatiquca
aatiquac aatcuiaq aatcuiqa aatcuaiq aatcuaqi aatcuqai aatcuqia aatciuaq aatciuqa aatciauq aatciaqu
aatciqau aatciqua aatcaiuq aatcaiqu aatcauiq aatcauqi aatcaqui aatcaqiu aatcqiau aatcqiua aatcqaiu
aatcqaui aatcquai aatcquia aatquica aatquiac aatqucia aatqucai aatquaci aatquaic aatqiuca aatqiuac
aatqicua aatqicau aatqiacu aatqiauc aatqciua aatqciau aatqcuia aatqcuai aatqcaui aatqcaiu aatqaicu
aatqaiuc aatqaciu aatqacui aatqauci aatqauic aaiatucq aaiatuqc aaiatcuq aaiatcqu aaiatqcu aaiatquc
aaiautcq aaiautqc aaiauctq aaiaucqt aaiauqct aaiauqtc aaiacutq aaiacuqt aaiactuq aaiactqu aaiacqtu
aaiacqut aaiaquct aaiaqutc aaiaqcut aaiaqctu aaiaqtcu aaiaqtuc aaitaucq aaitauqc aaitacuq aaitacqu
aaitaqcu aaitaquc aaituacq aaituaqc aaitucaq aaitucqa aaituqca aaituqac aaitcuaq aaitcuqa aaitcauq
aaitcaqu aaitcqau aaitcqua aaitquca aaitquac aaitqcua aaitqcau aaitqacu aaitqauc aaiutacq aaiutaqc
aaiutcaq aaiutcqa aaiutqca aaiutqac aaiuatcq aaiuatqc aaiuactq aaiuacqt aaiuaqct aaiuaqtc aaiucatq
aaiucaqt aaiuctaq aaiuctqa aaiucqta aaiucqat aaiuqact aaiuqatc aaiuqcat aaiuqcta aaiuqtca aaiuqtac
aaictuaq aaictuqa aaictauq aaictaqu aaictqau aaictqua aaicutaq aaicutqa aaicuatq aaicuaqt aaicuqat
aaicuqta aaicautq aaicauqt aaicatuq aaicatqu aaicaqtu aaicaqut aaicquat aaicquta aaicqaut aaicqatu
aaicqtau aaicqtua aaiqtuca aaiqtuac aaiqtcua aaiqtcau aaiqtacu aaiqtauc aaiqutca aaiqutac aaiqucta
aaiqucat aaiquact aaiquatc aaiqcuta aaiqcuat aaiqctua aaiqctau aaiqcatu aaiqcaut aaiqauct aaiqautc
aaiqacut aaiqactu aaiqatcu aaiqatuc aacatiuq aacatiqu aacatuiq aacatuqi aacatqui aacatqiu aacaituq
aacaitqu aacaiutq aacaiuqt aacaiqut aacaiqtu aacauitq aacauiqt aacautiq aacautqi aacauqti aacauqit
aacaqiut aacaqitu aacaquit aacaquti aacaqtui aacaqtiu aactaiuq aactaiqu aactauiq aactauqi aactaqui
aactaqiu aactiauq aactiaqu aactiuaq aactiuqa aactiqua aactiqau aactuiaq aactuiqa aactuaiq aactuaqi
aactuqai aactuqia aactqiua aactqiau aactquia aactquai aactqaui aactqaiu aacitauq aacitaqu aacituaq
aacituqa aacitqua aacitqau aaciatuq aaciatqu aaciautq aaciauqt aaciaqut aaciaqtu aaciuatq aaciuaqt
aaciutaq aaciutqa aaciuqta aaciuqat aaciqaut aaciqatu aaciquat aaciquta aaciqtua aaciqtau aacutiaq
aacutiqa aacutaiq aacutaqi aacutqai aacutqia aacuitaq aacuitqa aacuiatq aacuiaqt aacuiqat aacuiqta
aacuaitq aacuaiqt aacuatiq aacuatqi aacuaqti aacuaqit aacuqiat aacuqita aacuqait aacuqati aacuqtai
aacuqtia aacqtiua aacqtiau aacqtuia aacqtuai aacqtaui aacqtaiu aacqitua aacqitau aacqiuta aacqiuat
aacqiaut aacqiatu aacquita aacquiat aacqutia aacqutai aacquati aacquait aacqaiut aacqaitu aacqauit
aacqauti aacqatui aacqatiu aaqaticu aaqatiuc aaqatciu aaqatcui aaqatuci aaqatuic aaqaitcu aaqaituc
aaqaictu aaqaicut aaqaiuct aaqaiutc aaqacitu aaqaciut aaqactiu aaqactui aaqacuti aaqacuit aaqauict
aaqauitc aaqaucit aaqaucti aaqautci aaqautic aaqtaicu aaqtaiuc aaqtaciu aaqtacui aaqtauci aaqtauic
aaqtiacu aaqtiauc aaqticau aaqticua aaqtiuca aaqtiuac aaqtciau aaqtciua aaqtcaiu aaqtcaui aaqtcuai
aaqtcuia aaqtuica aaqtuiac aaqtucia aaqtucai aaqtuaci aaqtuaic aaqitacu aaqitauc aaqitcau aaqitcua
aaqituca aaqituac aaqiatcu aaqiatuc aaqiactu aaqiacut aaqiauct aaqiautc aaqicatu aaqicaut aaqictau
aaqictua aaqicuta aaqicuat aaqiuact aaqiuatc aaqiucat aaqiucta aaqiutca aaqiutac aaqctiau aaqctiua
aaqctaiu aaqctaui aaqctuai aaqctuia aaqcitau aaqcitua aaqciatu aaqciaut aaqciuat aaqciuta aaqcaitu
aaqcaiut aaqcatiu aaqcatui aaqcauti aaqcauit aaqcuiat aaqcuita aaqcuait aaqcuati aaqcutai aaqcutia
aaqutica aaqutiac aaqutcia aaqutcai aaqutaci aaqutaic aaquitca aaquitac aaquicta aaquicat aaquiact
aaquiatc aaqucita aaquciat aaquctia aaquctai aaqucati aaqucait aaquaict aaquaitc aaquacit aaquacti
aaquatci aaquatic

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us