easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

spasticities

petroleum

candlelights

tectus

fervanite

bifer

pepita

xanthocyanopsy

murrie

gallarza

windish

teasellike

rediscount

volventibus

ultrahouse

yaghlane

williamt

seduceth


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: appellareminique
cipher variations:
bqqfmmbsfnjojrvf crrgnnctgokpkswg dsshooduhplqltxh ettippeviqmrmuyi fuujqqfwjrnsnvzj
gvvkrrgxksotowak hwwlsshyltpupxbl ixxmttizmuqvqycm jyynuujanvrwrzdn kzzovvkbowsxsaeo
laapwwlcpxtytbfp mbbqxxmdqyuzucgq nccryynerzvavdhr oddszzofsawbweis peetaapgtbxcxfjt
qffubbqhucydygku rggvccrivdzezhlv shhwddsjweafaimw tiixeetkxfbgbjnx ujjyffulygchckoy
vkkzggvmzhdidlpz wllahhwnaiejemqa xmmbiixobjfkfnrb ynncjjypckglgosc zoodkkzqdlhmhptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: appellareminique
Cipher: zkkvoozivnrmrjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: appellareminique
Cipher: AAAAA ABBBA ABBBA AABAA ABABA ABABA AAAAA BAAAA AABAA ABABB ABAAA ABBAA ABAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: appellareminique
cipher variations:
bqqfmmbsfnjojrvfbuuniibanlzozxjnbyyveebivjpopdxvbccdaabqdhfofjldbgglwwbylfvovpzlbkktssbgtdlolvntbssjkkbwjzrorhpjbwwrggberxhohndr
baazccbmzvxoxtrzbeehyybuhtnonzfhbiipuubcprdodftpbmmxqqbkxptotlhxcrrgnnctgokpkswgcvvojjcbomapaykoczzwffcjwkqpqeywcddebbcreigpgkme
chhmxxczmgwpwqamclluttchuempmwoucttkllcxkaspsiqkcxxshhcfsyipioescbbaddcnawypyusacffizzcviuopoagicjjqvvcdqsepeguqcnnyrrclyqupumiy
dsshooduhplqltxhdwwpkkdcpnbqbzlpdaaxggdkxlrqrfzxdeefccdsfjhqhlnfdiinyydanhxqxrbndmmvuudivfnqnxpvduulmmdylbtqtjrldyytiidgtzjqjpft
dccbeedobxzqzvtbdggjaadwjvpqpbhjdkkrwwdertfqfhvrdoozssdmzrvqvnjzettippeviqmrmuyiexxqlledqocrcamqebbyhhelymsrsgayeffgddetgkirimog
ejjozzeboiyryscoennwvvejwgoroyqwevvmnnezmcuruksmezzujjehuakrkqgueddcffepcyarawucehhkbbexkwqrqcikellsxxefsugrgiwseppattenaswrwoka
fuujqqfwjrnsnvzjfyyrmmferpdsdbnrfccziifmzntsthbzfggheefuhljsjnphfkkpaafcpjzsztdpfooxwwfkxhpspzrxfwwnoofandvsvltnfaavkkfivblslrhv
feedggfqdzbsbxvdfiilccfylxrsrdjlfmmtyyfgtvhshjxtfqqbuufobtxsxplbgvvkrrgxksotowakgzzsnngfsqetecosgddajjgnaoutuicaghhiffgvimktkoqi
gllqbbgdqkataueqgppyxxglyiqtqasygxxoppgboewtwmuogbbwllgjwcmtmsiwgffehhgreactcywegjjmddgzmystsekmgnnuzzghuwitikyugrrcvvgpcuytyqmc
hwwlsshyltpupxblhaatoohgtrfufdptheebkkhobpvuvjdbhiijgghwjnlulprjhmmrccherlbubvfrhqqzyyhmzjrurbtzhyypqqhcpfxuxnvphccxmmhkxdnuntjx
hggfiihsfbdudzxfhkkneehanztutflnhoovaahivxjujlzvhssdwwhqdvzuzrndixxmttizmuqvqycmibbuppihusgvgequiffcllipcqwvwkecijjkhhixkomvmqsk
innsddifsmcvcwgsirrazzinaksvscuaizzqrridqgyvyowqiddynnilyeovoukyihhgjjitgceveaygilloffiboauvugmoippwbbijwykvkmawittexxirewavasoe
jyynuujanvrwrzdnjccvqqjivthwhfrvjggdmmjqdrxwxlfdjkkliijylpnwnrtljooteejgtndwdxhtjssbaajobltwtdvbjaarssjerhzwzpxrjeezoojmzfpwpvlz
jiihkkjuhdfwfbzhjmmpggjcpbvwvhnpjqqxccjkxzlwlnbxjuufyyjsfxbwbtpfkzzovvkbowsxsaeokddwrrkjwuixigswkhhennkresyxymgekllmjjkzmqoxosum
kppuffkhuoexeyiukttcbbkpcmuxuewckbbsttkfsiaxaqyskffappknagqxqwmakjjillkviegxgcaiknnqhhkdqcwxwioqkrryddklyamxmocykvvgzzktgycxcuqg
laapwwlcpxtytbfpleexsslkxvjyjhtxliifoolsftzyznhflmmnkklanrpyptvnlqqvgglivpfyfzjvluudcclqdnvyvfxdlcctuulgtjbybrztlggbqqlobhryrxnb
lkkjmmlwjfhyhdbjlooriilerdxyxjprlsszeelmzbnynpdzlwwhaaluhzdydvrhmbbqxxmdqyuzucgqmffyttmlywkzkiuymjjgppmtguazaoigmnnollmbosqzquwo
mrrwhhmjwqgzgakwmvveddmreowzwgyemdduvvmhukczcsaumhhcrrmpciszsyocmllknnmxkgizieckmppsjjmfseyzykqsmttaffmnacozoqeamxxibbmviaezewsi
nccryynerzvavdhrnggzuunmzxlaljvznkkhqqnuhvbabpjhnoopmmncptrarvxpnssxiinkxrhahblxnwwfeensfpxaxhzfneevwwnivldadtbvniidssnqdjtatzpd
nmmloonylhjajfdlnqqtkkngtfzazlrtnuubggnobdpaprfbnyyjccnwjbfafxtjoddszzofsawbweisohhavvonaymbmkwaollirroviwcbcqkioppqnnodqusbswyq
ottyjjolysibicmyoxxgffotgqybyiagoffwxxojwmebeucwojjettorekubuaqeonnmppozmikbkgemorrullohugabamsuovvchhopceqbqsgcozzkddoxkcgbgyuk
peetaapgtbxcxfjtpiibwwpobzncnlxbpmmjsspwjxdcdrljpqqroopervtctxzrpuuzkkpmztjcjdnzpyyhggpuhrzczjbhpggxyypkxnfcfvdxpkkfuupsflvcvbrf
poonqqpanjlclhfnpssvmmpivhbcbntvpwwdiipqdfrcrthdpaaleepyldhchzvlqffubbqhucydygkuqjjcxxqpcaodomycqnnkttqxkyedesmkqrrsppqfswuduyas
qvvallqnaukdkeoaqzzihhqvisadakciqhhyzzqlyogdgweyqllgvvqtgmwdwcsgqpporrqbokmdmigoqttwnnqjwicdcouwqxxejjqregsdsuieqbbmffqzmeidiawm
rggvccrivdzezhlvrkkdyyrqdbpepnzdrooluurylzfeftnlrsstqqrgtxvevzbtrwwbmmrobvlelfpbraajiirwjtbebldjriizaarmzphehxfzrmmhwwruhnxexdth
rqqpssrcplnenjhpruuxoorkxjdedpvxryyfkkrsfhtetvjfrccnggranfjejbxnshhwddsjweafaimwsllezzsrecqfqoaesppmvvszmagfguomstturrshuywfwacu
sxxcnnspcwmfmgqcsbbkjjsxkucfcmeksjjabbsnaqifiygasnnixxsvioyfyeuisrrqttsdqmofokiqsvvyppslykefeqwyszzgllstgiufuwkgsddohhsbogkfkcyo
tiixeetkxfbgbjnxtmmfaatsfdrgrpbftqqnwwtanbhghvpntuuvsstivzxgxbdvtyydootqdxngnhrdtcclkktylvdgdnfltkkbcctobrjgjzhbtoojyytwjpzgzfvj
tssruuternpgpljrtwwzqqtmzlfgfrxztaahmmtuhjvgvxlhteepiitcphlgldzpujjyffulygchckoyunngbbutgeshsqcgurroxxubocihiwqouvvwttujwayhycew
uzzeppureyohoiseuddmlluzmweheogmullcddupcskhkaicuppkzzuxkqahagwkuttsvvufsoqhqmksuxxarrunamghgsyaubbinnuvikwhwymiuffqjjudqimhmeaq
vkkzggvmzhdidlpzvoohccvuhftitrdhvsspyyvcpdjijxrpvwwxuuvkxbzizdfxvaafqqvsfzpipjtfveenmmvanxfifphnvmmdeevqdtlilbjdvqqlaavylrbibhxl
vuutwwvgtprirnltvyybssvobnhihtzbvccjoovwjlxixznjvggrkkverjninfbrwllahhwnaiejemqawppiddwvigujuseiwttqzzwdqekjkysqwxxyvvwlycajaegy
wbbgrrwtgaqjqkugwffonnwboygjgqiownneffwreumjmckewrrmbbwzmscjciymwvvuxxwhuqsjsomuwzzcttwpcoijiuacwddkppwxkmyjyaokwhhsllwfskojogcs
xmmbiixobjfkfnrbxqqjeexwjhvkvtfjxuuraaxerflklztrxyyzwwxmzdbkbfhzxcchssxuhbrkrlvhxggpooxcpzhkhrjpxoofggxsfvnkndlfxssnccxantdkdjzn
xwwvyyxivrtktpnvxaaduuxqdpjkjvbdxeelqqxylnzkzbplxiitmmxgtlpkphdtynncjjypckglgoscyrrkffyxkiwlwugkyvvsbbyfsgmlmausyzzaxxynaeclcgia
yddittyvicslsmwiyhhqppydqailiskqyppghhytgwoloemgyttoddybouelekaoyxxwzzyjwsuluqowybbevvyreqklkwceyffmrryzmoalacqmyjjunnyhumqlqieu
zoodkkzqdlhmhptdzsslggzyljxmxvhlzwwtcczgthnmnbvtzaabyyzobfdmdhjbzeejuuzwjdtmtnxjziirqqzerbjmjtlrzqqhiizuhxpmpfnhzuupeezcpvfmflbp
zyyxaazkxtvmvrpxzccfwwzsfrlmlxdfzggnsszanpbmbdrnzkkvoozivnrmrjfvappellareminiqueattmhhazmkynywimaxxuddahuionocwuabbczzapcgeneikc
affkvvaxkeunuoykajjsrrafscknkumsarrijjaviyqnqgoiavvqffadqwgngmcqazzybbalyuwnwsqyaddgxxatgsmnmyegahhottaboqcncesoallwppajwosnskgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: appellareminique
Cipher: nccryynerzvavdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: appellareminique
Cipher: 11535351131311245123423342145451

Extended Methods:
Method #1

Plaintext: appellareminique
method variations:
fuukqqfwkrosovzklzzpvvlbpwtxtaepqeeuaaqgubycyfkuvkkzffvmzgdhdlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a p p e l l a r e m i n i q u e 
1 5 5 5 1 1 1 2 5 2 4 3 4 1 5 5 
1 3 3 1 3 3 1 4 1 3 2 3 2 4 4 1 
They are then read out in rows:
15551112524341551331331413232441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: appellareminique
Cipher: vzafkodzlcnqlmrd

Read more ...
Method #3

Plaintext: appellareminique
method variations:
vxxaccfyfsmsbyya xxaccfyfsmsbyyav xaccfyfsmsbyyavx
accfyfsmsbyyavxx ccfyfsmsbyyavxxa cfyfsmsbyyavxxac
fyfsmsbyyavxxacc yfsmsbyyavxxaccf fsmsbyyavxxaccfy
smsbyyavxxaccfyf msbyyavxxaccfyfs sbyyavxxaccfyfsm
byyavxxaccfyfsms yyavxxaccfyfsmsb yavxxaccfyfsmsby
avxxaccfyfsmsbyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: appellareminique

first 5040 cipher variations(20814114471463 total)
appellareminique appellareminiqeu appellareminiuqe appellareminiueq appellareminieuq appellareminiequ appellareminqiue
appellareminqieu appellareminquie appellareminquei appellareminqeui appellareminqeiu appellareminuqie appellareminuqei
appellareminuiqe appellareminuieq appellareminueiq appellareminueqi appellareminequi appellaremineqiu appellaremineuqi
appellaremineuiq appellaremineiuq appellaremineiqu appellaremiinque appellaremiinqeu appellaremiinuqe appellaremiinueq
appellaremiineuq appellaremiinequ appellaremiiqnue appellaremiiqneu appellaremiiqune appellaremiiquen appellaremiiqeun
appellaremiiqenu appellaremiiuqne appellaremiiuqen appellaremiiunqe appellaremiiuneq appellaremiiuenq appellaremiiueqn
appellaremiiequn appellaremiieqnu appellaremiieuqn appellaremiieunq appellaremiienuq appellaremiienqu appellaremiqinue
appellaremiqineu appellaremiqiune appellaremiqiuen appellaremiqieun appellaremiqienu appellaremiqniue appellaremiqnieu
appellaremiqnuie appellaremiqnuei appellaremiqneui appellaremiqneiu appellaremiqunie appellaremiqunei appellaremiquine
appellaremiquien appellaremiquein appellaremiqueni appellaremiqenui appellaremiqeniu appellaremiqeuni appellaremiqeuin
appellaremiqeiun appellaremiqeinu appellaremiuiqne appellaremiuiqen appellaremiuinqe appellaremiuineq appellaremiuienq
appellaremiuieqn appellaremiuqine appellaremiuqien appellaremiuqnie appellaremiuqnei appellaremiuqeni appellaremiuqein
appellaremiunqie appellaremiunqei appellaremiuniqe appellaremiunieq appellaremiuneiq appellaremiuneqi appellaremiueqni
appellaremiueqin appellaremiuenqi appellaremiueniq appellaremiueinq appellaremiueiqn appellaremieiqun appellaremieiqnu
appellaremieiuqn appellaremieiunq appellaremieinuq appellaremieinqu appellaremieqiun appellaremieqinu appellaremiequin
appellaremiequni appellaremieqnui appellaremieqniu appellaremieuqin appellaremieuqni appellaremieuiqn appellaremieuinq
appellaremieuniq appellaremieunqi appellaremienqui appellaremienqiu appellaremienuqi appellaremienuiq appellaremieniuq
appellaremieniqu appellaremniique appellaremniiqeu appellaremniiuqe appellaremniiueq appellaremniieuq appellaremniiequ
appellaremniqiue appellaremniqieu appellaremniquie appellaremniquei appellaremniqeui appellaremniqeiu appellaremniuqie
appellaremniuqei appellaremniuiqe appellaremniuieq appellaremniueiq appellaremniueqi appellaremniequi appellaremnieqiu
appellaremnieuqi appellaremnieuiq appellaremnieiuq appellaremnieiqu appellaremniique appellaremniiqeu appellaremniiuqe
appellaremniiueq appellaremniieuq appellaremniiequ appellaremniqiue appellaremniqieu appellaremniquie appellaremniquei
appellaremniqeui appellaremniqeiu appellaremniuqie appellaremniuqei appellaremniuiqe appellaremniuieq appellaremniueiq
appellaremniueqi appellaremniequi appellaremnieqiu appellaremnieuqi appellaremnieuiq appellaremnieiuq appellaremnieiqu
appellaremnqiiue appellaremnqiieu appellaremnqiuie appellaremnqiuei appellaremnqieui appellaremnqieiu appellaremnqiiue
appellaremnqiieu appellaremnqiuie appellaremnqiuei appellaremnqieui appellaremnqieiu appellaremnquiie appellaremnquiei
appellaremnquiie appellaremnquiei appellaremnqueii appellaremnqueii appellaremnqeiui appellaremnqeiiu appellaremnqeuii
appellaremnqeuii appellaremnqeiui appellaremnqeiiu appellaremnuiqie appellaremnuiqei appellaremnuiiqe appellaremnuiieq
appellaremnuieiq appellaremnuieqi appellaremnuqiie appellaremnuqiei appellaremnuqiie appellaremnuqiei appellaremnuqeii
appellaremnuqeii appellaremnuiqie appellaremnuiqei appellaremnuiiqe appellaremnuiieq appellaremnuieiq appellaremnuieqi
appellaremnueqii appellaremnueqii appellaremnueiqi appellaremnueiiq appellaremnueiiq appellaremnueiqi appellaremneiqui
appellaremneiqiu appellaremneiuqi appellaremneiuiq appellaremneiiuq appellaremneiiqu appellaremneqiui appellaremneqiiu
appellaremnequii appellaremnequii appellaremneqiui appellaremneqiiu appellaremneuqii appellaremneuqii appellaremneuiqi
appellaremneuiiq appellaremneuiiq appellaremneuiqi appellaremneiqui appellaremneiqiu appellaremneiuqi appellaremneiuiq
appellaremneiiuq appellaremneiiqu appellareminique appellareminiqeu appellareminiuqe appellareminiueq appellareminieuq
appellareminiequ appellareminqiue appellareminqieu appellareminquie appellareminquei appellareminqeui appellareminqeiu
appellareminuqie appellareminuqei appellareminuiqe appellareminuieq appellareminueiq appellareminueqi appellareminequi
appellaremineqiu appellaremineuqi appellaremineuiq appellaremineiuq appellaremineiqu appellaremiinque appellaremiinqeu
appellaremiinuqe appellaremiinueq appellaremiineuq appellaremiinequ appellaremiiqnue appellaremiiqneu appellaremiiqune
appellaremiiquen appellaremiiqeun appellaremiiqenu appellaremiiuqne appellaremiiuqen appellaremiiunqe appellaremiiuneq
appellaremiiuenq appellaremiiueqn appellaremiiequn appellaremiieqnu appellaremiieuqn appellaremiieunq appellaremiienuq
appellaremiienqu appellaremiqinue appellaremiqineu appellaremiqiune appellaremiqiuen appellaremiqieun appellaremiqienu
appellaremiqniue appellaremiqnieu appellaremiqnuie appellaremiqnuei appellaremiqneui appellaremiqneiu appellaremiqunie
appellaremiqunei appellaremiquine appellaremiquien appellaremiquein appellaremiqueni appellaremiqenui appellaremiqeniu
appellaremiqeuni appellaremiqeuin appellaremiqeiun appellaremiqeinu appellaremiuiqne appellaremiuiqen appellaremiuinqe
appellaremiuineq appellaremiuienq appellaremiuieqn appellaremiuqine appellaremiuqien appellaremiuqnie appellaremiuqnei
appellaremiuqeni appellaremiuqein appellaremiunqie appellaremiunqei appellaremiuniqe appellaremiunieq appellaremiuneiq
appellaremiuneqi appellaremiueqni appellaremiueqin appellaremiuenqi appellaremiueniq appellaremiueinq appellaremiueiqn
appellaremieiqun appellaremieiqnu appellaremieiuqn appellaremieiunq appellaremieinuq appellaremieinqu appellaremieqiun
appellaremieqinu appellaremiequin appellaremiequni appellaremieqnui appellaremieqniu appellaremieuqin appellaremieuqni
appellaremieuiqn appellaremieuinq appellaremieuniq appellaremieunqi appellaremienqui appellaremienqiu appellaremienuqi
appellaremienuiq appellaremieniuq appellaremieniqu appellaremqniiue appellaremqniieu appellaremqniuie appellaremqniuei
appellaremqnieui appellaremqnieiu appellaremqniiue appellaremqniieu appellaremqniuie appellaremqniuei appellaremqnieui
appellaremqnieiu appellaremqnuiie appellaremqnuiei appellaremqnuiie appellaremqnuiei appellaremqnueii appellaremqnueii
appellaremqneiui appellaremqneiiu appellaremqneuii appellaremqneuii appellaremqneiui appellaremqneiiu appellaremqiniue
appellaremqinieu appellaremqinuie appellaremqinuei appellaremqineui appellaremqineiu appellaremqiinue appellaremqiineu
appellaremqiiune appellaremqiiuen appellaremqiieun appellaremqiienu appellaremqiuine appellaremqiuien appellaremqiunie
appellaremqiunei appellaremqiueni appellaremqiuein appellaremqieiun appellaremqieinu appellaremqieuin appellaremqieuni
appellaremqienui appellaremqieniu appellaremqiinue appellaremqiineu appellaremqiiune appellaremqiiuen appellaremqiieun
appellaremqiienu appellaremqiniue appellaremqinieu appellaremqinuie appellaremqinuei appellaremqineui appellaremqineiu
appellaremqiunie appellaremqiunei appellaremqiuine appellaremqiuien appellaremqiuein appellaremqiueni appellaremqienui
appellaremqieniu appellaremqieuni appellaremqieuin appellaremqieiun appellaremqieinu appellaremquiine appellaremquiien
appellaremquinie appellaremquinei appellaremquieni appellaremquiein appellaremquiine appellaremquiien appellaremquinie
appellaremquinei appellaremquieni appellaremquiein appellaremquniie appellaremquniei appellaremquniie appellaremquniei
appellaremquneii appellaremquneii appellaremqueini appellaremqueiin appellaremquenii appellaremquenii appellaremqueini
appellaremqueiin appellaremqeiiun appellaremqeiinu appellaremqeiuin appellaremqeiuni appellaremqeinui appellaremqeiniu
appellaremqeiiun appellaremqeiinu appellaremqeiuin appellaremqeiuni appellaremqeinui appellaremqeiniu appellaremqeuiin
appellaremqeuini appellaremqeuiin appellaremqeuini appellaremqeunii appellaremqeunii appellaremqeniui appellaremqeniiu
appellaremqenuii appellaremqenuii appellaremqeniui appellaremqeniiu appellaremuniqie appellaremuniqei appellaremuniiqe
appellaremuniieq appellaremunieiq appellaremunieqi appellaremunqiie appellaremunqiei appellaremunqiie appellaremunqiei
appellaremunqeii appellaremunqeii appellaremuniqie appellaremuniqei appellaremuniiqe appellaremuniieq appellaremunieiq
appellaremunieqi appellaremuneqii appellaremuneqii appellaremuneiqi appellaremuneiiq appellaremuneiiq appellaremuneiqi
appellaremuinqie appellaremuinqei appellaremuiniqe appellaremuinieq appellaremuineiq appellaremuineqi appellaremuiqnie
appellaremuiqnei appellaremuiqine appellaremuiqien appellaremuiqein appellaremuiqeni appellaremuiiqne appellaremuiiqen
appellaremuiinqe appellaremuiineq appellaremuiienq appellaremuiieqn appellaremuieqin appellaremuieqni appellaremuieiqn
appellaremuieinq appellaremuieniq appellaremuienqi appellaremuqinie appellaremuqinei appellaremuqiine appellaremuqiien
appellaremuqiein appellaremuqieni appellaremuqniie appellaremuqniei appellaremuqniie appellaremuqniei appellaremuqneii
appellaremuqneii appellaremuqinie appellaremuqinei appellaremuqiine appellaremuqiien appellaremuqiein appellaremuqieni
appellaremuqenii appellaremuqenii appellaremuqeini appellaremuqeiin appellaremuqeiin appellaremuqeini appellaremuiiqne
appellaremuiiqen appellaremuiinqe appellaremuiineq appellaremuiienq appellaremuiieqn appellaremuiqine appellaremuiqien
appellaremuiqnie appellaremuiqnei appellaremuiqeni appellaremuiqein appellaremuinqie appellaremuinqei appellaremuiniqe
appellaremuinieq appellaremuineiq appellaremuineqi appellaremuieqni appellaremuieqin appellaremuienqi appellaremuieniq
appellaremuieinq appellaremuieiqn appellaremueiqin appellaremueiqni appellaremueiiqn appellaremueiinq appellaremueiniq
appellaremueinqi appellaremueqiin appellaremueqini appellaremueqiin appellaremueqini appellaremueqnii appellaremueqnii
appellaremueiqin appellaremueiqni appellaremueiiqn appellaremueiinq appellaremueiniq appellaremueinqi appellaremuenqii
appellaremuenqii appellaremueniqi appellaremueniiq appellaremueniiq appellaremueniqi appellaremeniqui appellaremeniqiu
appellaremeniuqi appellaremeniuiq appellaremeniiuq appellaremeniiqu appellaremenqiui appellaremenqiiu appellaremenquii
appellaremenquii appellaremenqiui appellaremenqiiu appellaremenuqii appellaremenuqii appellaremenuiqi appellaremenuiiq
appellaremenuiiq appellaremenuiqi appellaremeniqui appellaremeniqiu appellaremeniuqi appellaremeniuiq appellaremeniiuq
appellaremeniiqu appellaremeinqui appellaremeinqiu appellaremeinuqi appellaremeinuiq appellaremeiniuq appellaremeiniqu
appellaremeiqnui appellaremeiqniu appellaremeiquni appellaremeiquin appellaremeiqiun appellaremeiqinu appellaremeiuqni
appellaremeiuqin appellaremeiunqi appellaremeiuniq appellaremeiuinq appellaremeiuiqn appellaremeiiqun appellaremeiiqnu
appellaremeiiuqn appellaremeiiunq appellaremeiinuq appellaremeiinqu appellaremeqinui appellaremeqiniu appellaremeqiuni
appellaremeqiuin appellaremeqiiun appellaremeqiinu appellaremeqniui appellaremeqniiu appellaremeqnuii appellaremeqnuii
appellaremeqniui appellaremeqniiu appellaremequnii appellaremequnii appellaremequini appellaremequiin appellaremequiin
appellaremequini appellaremeqinui appellaremeqiniu appellaremeqiuni appellaremeqiuin appellaremeqiiun appellaremeqiinu
appellaremeuiqni appellaremeuiqin appellaremeuinqi appellaremeuiniq appellaremeuiinq appellaremeuiiqn appellaremeuqini
appellaremeuqiin appellaremeuqnii appellaremeuqnii appellaremeuqini appellaremeuqiin appellaremeunqii appellaremeunqii
appellaremeuniqi appellaremeuniiq appellaremeuniiq appellaremeuniqi appellaremeuiqni appellaremeuiqin appellaremeuinqi
appellaremeuiniq appellaremeuiinq appellaremeuiiqn appellaremeiiqun appellaremeiiqnu appellaremeiiuqn appellaremeiiunq
appellaremeiinuq appellaremeiinqu appellaremeiqiun appellaremeiqinu appellaremeiquin appellaremeiquni appellaremeiqnui
appellaremeiqniu appellaremeiuqin appellaremeiuqni appellaremeiuiqn appellaremeiuinq appellaremeiuniq appellaremeiunqi
appellaremeinqui appellaremeinqiu appellaremeinuqi appellaremeinuiq appellaremeiniuq appellaremeiniqu appellareimnique
appellareimniqeu appellareimniuqe appellareimniueq appellareimnieuq appellareimniequ appellareimnqiue appellareimnqieu
appellareimnquie appellareimnquei appellareimnqeui appellareimnqeiu appellareimnuqie appellareimnuqei appellareimnuiqe
appellareimnuieq appellareimnueiq appellareimnueqi appellareimnequi appellareimneqiu appellareimneuqi appellareimneuiq
appellareimneiuq appellareimneiqu appellareiminque appellareiminqeu appellareiminuqe appellareiminueq appellareimineuq
appellareiminequ appellareimiqnue appellareimiqneu appellareimiqune appellareimiquen appellareimiqeun appellareimiqenu
appellareimiuqne appellareimiuqen appellareimiunqe appellareimiuneq appellareimiuenq appellareimiueqn appellareimiequn
appellareimieqnu appellareimieuqn appellareimieunq appellareimienuq appellareimienqu appellareimqinue appellareimqineu
appellareimqiune appellareimqiuen appellareimqieun appellareimqienu appellareimqniue appellareimqnieu appellareimqnuie
appellareimqnuei appellareimqneui appellareimqneiu appellareimqunie appellareimqunei appellareimquine appellareimquien
appellareimquein appellareimqueni appellareimqenui appellareimqeniu appellareimqeuni appellareimqeuin appellareimqeiun
appellareimqeinu appellareimuiqne appellareimuiqen appellareimuinqe appellareimuineq appellareimuienq appellareimuieqn
appellareimuqine appellareimuqien appellareimuqnie appellareimuqnei appellareimuqeni appellareimuqein appellareimunqie
appellareimunqei appellareimuniqe appellareimunieq appellareimuneiq appellareimuneqi appellareimueqni appellareimueqin
appellareimuenqi appellareimueniq appellareimueinq appellareimueiqn appellareimeiqun appellareimeiqnu appellareimeiuqn
appellareimeiunq appellareimeinuq appellareimeinqu appellareimeqiun appellareimeqinu appellareimequin appellareimequni
appellareimeqnui appellareimeqniu appellareimeuqin appellareimeuqni appellareimeuiqn appellareimeuinq appellareimeuniq
appellareimeunqi appellareimenqui appellareimenqiu appellareimenuqi appellareimenuiq appellareimeniuq appellareimeniqu
appellareinmique appellareinmiqeu appellareinmiuqe appellareinmiueq appellareinmieuq appellareinmiequ appellareinmqiue
appellareinmqieu appellareinmquie appellareinmquei appellareinmqeui appellareinmqeiu appellareinmuqie appellareinmuqei
appellareinmuiqe appellareinmuieq appellareinmueiq appellareinmueqi appellareinmequi appellareinmeqiu appellareinmeuqi
appellareinmeuiq appellareinmeiuq appellareinmeiqu appellareinimque appellareinimqeu appellareinimuqe appellareinimueq
appellareinimeuq appellareinimequ appellareiniqmue appellareiniqmeu appellareiniqume appellareiniquem appellareiniqeum
appellareiniqemu appellareiniuqme appellareiniuqem appellareiniumqe appellareiniumeq appellareiniuemq appellareiniueqm
appellareiniequm appellareinieqmu appellareinieuqm appellareinieumq appellareiniemuq appellareiniemqu appellareinqimue
appellareinqimeu appellareinqiume appellareinqiuem appellareinqieum appellareinqiemu appellareinqmiue appellareinqmieu
appellareinqmuie appellareinqmuei appellareinqmeui appellareinqmeiu appellareinqumie appellareinqumei appellareinquime
appellareinquiem appellareinqueim appellareinquemi appellareinqemui appellareinqemiu appellareinqeumi appellareinqeuim
appellareinqeium appellareinqeimu appellareinuiqme appellareinuiqem appellareinuimqe appellareinuimeq appellareinuiemq
appellareinuieqm appellareinuqime appellareinuqiem appellareinuqmie appellareinuqmei appellareinuqemi appellareinuqeim
appellareinumqie appellareinumqei appellareinumiqe appellareinumieq appellareinumeiq appellareinumeqi appellareinueqmi
appellareinueqim appellareinuemqi appellareinuemiq appellareinueimq appellareinueiqm appellareineiqum appellareineiqmu
appellareineiuqm appellareineiumq appellareineimuq appellareineimqu appellareineqium appellareineqimu appellareinequim
appellareinequmi appellareineqmui appellareineqmiu appellareineuqim appellareineuqmi appellareineuiqm appellareineuimq
appellareineumiq appellareineumqi appellareinemqui appellareinemqiu appellareinemuqi appellareinemuiq appellareinemiuq
appellareinemiqu appellareiinmque appellareiinmqeu appellareiinmuqe appellareiinmueq appellareiinmeuq appellareiinmequ
appellareiinqmue appellareiinqmeu appellareiinqume appellareiinquem appellareiinqeum appellareiinqemu appellareiinuqme
appellareiinuqem appellareiinumqe appellareiinumeq appellareiinuemq appellareiinueqm appellareiinequm appellareiineqmu
appellareiineuqm appellareiineumq appellareiinemuq appellareiinemqu appellareiimnque appellareiimnqeu appellareiimnuqe
appellareiimnueq appellareiimneuq appellareiimnequ appellareiimqnue appellareiimqneu appellareiimqune appellareiimquen
appellareiimqeun appellareiimqenu appellareiimuqne appellareiimuqen appellareiimunqe appellareiimuneq appellareiimuenq
appellareiimueqn appellareiimequn appellareiimeqnu appellareiimeuqn appellareiimeunq appellareiimenuq appellareiimenqu
appellareiiqmnue appellareiiqmneu appellareiiqmune appellareiiqmuen appellareiiqmeun appellareiiqmenu appellareiiqnmue
appellareiiqnmeu appellareiiqnume appellareiiqnuem appellareiiqneum appellareiiqnemu appellareiiqunme appellareiiqunem
appellareiiqumne appellareiiqumen appellareiiquemn appellareiiquenm appellareiiqenum appellareiiqenmu appellareiiqeunm
appellareiiqeumn appellareiiqemun appellareiiqemnu appellareiiumqne appellareiiumqen appellareiiumnqe appellareiiumneq
appellareiiumenq appellareiiumeqn appellareiiuqmne appellareiiuqmen appellareiiuqnme appellareiiuqnem appellareiiuqenm
appellareiiuqemn appellareiiunqme appellareiiunqem appellareiiunmqe appellareiiunmeq appellareiiunemq appellareiiuneqm
appellareiiueqnm appellareiiueqmn appellareiiuenqm appellareiiuenmq appellareiiuemnq appellareiiuemqn appellareiiemqun
appellareiiemqnu appellareiiemuqn appellareiiemunq appellareiiemnuq appellareiiemnqu appellareiieqmun appellareiieqmnu
appellareiiequmn appellareiiequnm appellareiieqnum appellareiieqnmu appellareiieuqmn appellareiieuqnm appellareiieumqn
appellareiieumnq appellareiieunmq appellareiieunqm appellareiienqum appellareiienqmu appellareiienuqm appellareiienumq
appellareiienmuq appellareiienmqu appellareiqnimue appellareiqnimeu appellareiqniume appellareiqniuem appellareiqnieum
appellareiqniemu appellareiqnmiue appellareiqnmieu appellareiqnmuie appellareiqnmuei appellareiqnmeui appellareiqnmeiu
appellareiqnumie appellareiqnumei appellareiqnuime appellareiqnuiem appellareiqnueim appellareiqnuemi appellareiqnemui
appellareiqnemiu appellareiqneumi appellareiqneuim appellareiqneium appellareiqneimu appellareiqinmue appellareiqinmeu
appellareiqinume appellareiqinuem appellareiqineum appellareiqinemu appellareiqimnue appellareiqimneu appellareiqimune
appellareiqimuen appellareiqimeun appellareiqimenu appellareiqiumne appellareiqiumen appellareiqiunme appellareiqiunem
appellareiqiuenm appellareiqiuemn appellareiqiemun appellareiqiemnu appellareiqieumn appellareiqieunm appellareiqienum
appellareiqienmu appellareiqminue appellareiqmineu appellareiqmiune appellareiqmiuen appellareiqmieun appellareiqmienu
appellareiqmniue appellareiqmnieu appellareiqmnuie appellareiqmnuei appellareiqmneui appellareiqmneiu appellareiqmunie
appellareiqmunei appellareiqmuine appellareiqmuien appellareiqmuein appellareiqmueni appellareiqmenui appellareiqmeniu
appellareiqmeuni appellareiqmeuin appellareiqmeiun appellareiqmeinu appellareiquimne appellareiquimen appellareiquinme
appellareiquinem appellareiquienm appellareiquiemn appellareiqumine appellareiqumien appellareiqumnie appellareiqumnei
appellareiqumeni appellareiqumein appellareiqunmie appellareiqunmei appellareiqunime appellareiquniem appellareiquneim
appellareiqunemi appellareiquemni appellareiquemin appellareiquenmi appellareiquenim appellareiqueinm appellareiqueimn
appellareiqeimun appellareiqeimnu appellareiqeiumn appellareiqeiunm appellareiqeinum appellareiqeinmu appellareiqemiun
appellareiqeminu appellareiqemuin appellareiqemuni appellareiqemnui appellareiqemniu appellareiqeumin appellareiqeumni
appellareiqeuimn appellareiqeuinm appellareiqeunim appellareiqeunmi appellareiqenmui appellareiqenmiu appellareiqenumi
appellareiqenuim appellareiqenium appellareiqenimu appellareiuniqme appellareiuniqem appellareiunimqe appellareiunimeq
appellareiuniemq appellareiunieqm appellareiunqime appellareiunqiem appellareiunqmie appellareiunqmei appellareiunqemi
appellareiunqeim appellareiunmqie appellareiunmqei appellareiunmiqe appellareiunmieq appellareiunmeiq appellareiunmeqi
appellareiuneqmi appellareiuneqim appellareiunemqi appellareiunemiq appellareiuneimq appellareiuneiqm appellareiuinqme
appellareiuinqem appellareiuinmqe appellareiuinmeq appellareiuinemq appellareiuineqm appellareiuiqnme appellareiuiqnem
appellareiuiqmne appellareiuiqmen appellareiuiqemn appellareiuiqenm appellareiuimqne appellareiuimqen appellareiuimnqe
appellareiuimneq appellareiuimenq appellareiuimeqn appellareiuieqmn appellareiuieqnm appellareiuiemqn appellareiuiemnq
appellareiuienmq appellareiuienqm appellareiuqinme appellareiuqinem appellareiuqimne appellareiuqimen appellareiuqiemn
appellareiuqienm appellareiuqnime appellareiuqniem appellareiuqnmie appellareiuqnmei appellareiuqnemi appellareiuqneim
appellareiuqmnie appellareiuqmnei appellareiuqmine appellareiuqmien appellareiuqmein appellareiuqmeni appellareiuqenmi
appellareiuqenim appellareiuqemni appellareiuqemin appellareiuqeimn appellareiuqeinm appellareiumiqne appellareiumiqen
appellareiuminqe appellareiumineq appellareiumienq appellareiumieqn appellareiumqine appellareiumqien appellareiumqnie
appellareiumqnei appellareiumqeni appellareiumqein appellareiumnqie appellareiumnqei appellareiumniqe appellareiumnieq
appellareiumneiq appellareiumneqi appellareiumeqni appellareiumeqin appellareiumenqi appellareiumeniq appellareiumeinq
appellareiumeiqn appellareiueiqmn appellareiueiqnm appellareiueimqn appellareiueimnq appellareiueinmq appellareiueinqm
appellareiueqimn appellareiueqinm appellareiueqmin appellareiueqmni appellareiueqnmi appellareiueqnim appellareiuemqin
appellareiuemqni appellareiuemiqn appellareiueminq appellareiuemniq appellareiuemnqi appellareiuenqmi appellareiuenqim
appellareiuenmqi appellareiuenmiq appellareiuenimq appellareiueniqm appellareieniqum appellareieniqmu appellareieniuqm
appellareieniumq appellareienimuq appellareienimqu appellareienqium appellareienqimu appellareienquim appellareienqumi
appellareienqmui appellareienqmiu appellareienuqim appellareienuqmi appellareienuiqm appellareienuimq appellareienumiq
appellareienumqi appellareienmqui appellareienmqiu appellareienmuqi appellareienmuiq appellareienmiuq appellareienmiqu
appellareieinqum appellareieinqmu appellareieinuqm appellareieinumq appellareieinmuq appellareieinmqu appellareieiqnum
appellareieiqnmu appellareieiqunm appellareieiqumn appellareieiqmun appellareieiqmnu appellareieiuqnm appellareieiuqmn
appellareieiunqm appellareieiunmq appellareieiumnq appellareieiumqn appellareieimqun appellareieimqnu appellareieimuqn
appellareieimunq appellareieimnuq appellareieimnqu appellareieqinum appellareieqinmu appellareieqiunm appellareieqiumn
appellareieqimun appellareieqimnu appellareieqnium appellareieqnimu appellareieqnuim appellareieqnumi appellareieqnmui
appellareieqnmiu appellareiequnim appellareiequnmi appellareiequinm appellareiequimn appellareiequmin appellareiequmni
appellareieqmnui appellareieqmniu appellareieqmuni appellareieqmuin appellareieqmiun appellareieqminu appellareieuiqnm
appellareieuiqmn appellareieuinqm appellareieuinmq appellareieuimnq appellareieuimqn appellareieuqinm appellareieuqimn
appellareieuqnim appellareieuqnmi appellareieuqmni appellareieuqmin appellareieunqim appellareieunqmi appellareieuniqm
appellareieunimq appellareieunmiq appellareieunmqi appellareieumqni appellareieumqin appellareieumnqi appellareieumniq
appellareieuminq appellareieumiqn appellareiemiqun appellareiemiqnu appellareiemiuqn appellareiemiunq appellareieminuq
appellareieminqu appellareiemqiun appellareiemqinu appellareiemquin appellareiemquni appellareiemqnui appellareiemqniu
appellareiemuqin appellareiemuqni appellareiemuiqn appellareiemuinq appellareiemuniq appellareiemunqi appellareiemnqui
appellareiemnqiu appellareiemnuqi appellareiemnuiq appellareiemniuq appellareiemniqu appellarenimique appellarenimiqeu
appellarenimiuqe appellarenimiueq appellarenimieuq appellarenimiequ appellarenimqiue appellarenimqieu appellarenimquie
appellarenimquei appellarenimqeui appellarenimqeiu appellarenimuqie appellarenimuqei appellarenimuiqe appellarenimuieq
appellarenimueiq appellarenimueqi appellarenimequi appellarenimeqiu appellarenimeuqi appellarenimeuiq appellarenimeiuq
appellarenimeiqu appellareniimque appellareniimqeu appellareniimuqe appellareniimueq appellareniimeuq appellareniimequ
appellareniiqmue appellareniiqmeu appellareniiqume appellareniiquem appellareniiqeum appellareniiqemu appellareniiuqme
appellareniiuqem appellareniiumqe appellareniiumeq appellareniiuemq appellareniiueqm appellareniiequm appellareniieqmu
appellareniieuqm appellareniieumq appellareniiemuq appellareniiemqu appellareniqimue appellareniqimeu appellareniqiume
appellareniqiuem appellareniqieum appellareniqiemu appellareniqmiue appellareniqmieu appellareniqmuie appellareniqmuei
appellareniqmeui appellareniqmeiu appellareniqumie appellareniqumei appellareniquime appellareniquiem appellareniqueim
appellareniquemi appellareniqemui appellareniqemiu appellareniqeumi appellareniqeuim appellareniqeium appellareniqeimu
appellareniuiqme appellareniuiqem appellareniuimqe appellareniuimeq appellareniuiemq appellareniuieqm appellareniuqime
appellareniuqiem appellareniuqmie appellareniuqmei appellareniuqemi appellareniuqeim appellareniumqie appellareniumqei
appellareniumiqe appellareniumieq appellareniumeiq appellareniumeqi appellareniueqmi appellareniueqim appellareniuemqi
appellareniuemiq appellareniueimq appellareniueiqm appellarenieiqum appellarenieiqmu appellarenieiuqm appellarenieiumq
appellarenieimuq appellarenieimqu appellarenieqium appellarenieqimu appellareniequim appellareniequmi appellarenieqmui
appellarenieqmiu appellarenieuqim appellarenieuqmi appellarenieuiqm appellarenieuimq appellarenieumiq appellarenieumqi
appellareniemqui appellareniemqiu appellareniemuqi appellareniemuiq appellareniemiuq appellareniemiqu appellarenmiique
appellarenmiiqeu appellarenmiiuqe appellarenmiiueq appellarenmiieuq appellarenmiiequ appellarenmiqiue appellarenmiqieu
appellarenmiquie appellarenmiquei appellarenmiqeui appellarenmiqeiu appellarenmiuqie appellarenmiuqei appellarenmiuiqe
appellarenmiuieq appellarenmiueiq appellarenmiueqi appellarenmiequi appellarenmieqiu appellarenmieuqi appellarenmieuiq
appellarenmieiuq appellarenmieiqu appellarenmiique appellarenmiiqeu appellarenmiiuqe appellarenmiiueq appellarenmiieuq
appellarenmiiequ appellarenmiqiue appellarenmiqieu appellarenmiquie appellarenmiquei appellarenmiqeui appellarenmiqeiu
appellarenmiuqie appellarenmiuqei appellarenmiuiqe appellarenmiuieq appellarenmiueiq appellarenmiueqi appellarenmiequi
appellarenmieqiu appellarenmieuqi appellarenmieuiq appellarenmieiuq appellarenmieiqu appellarenmqiiue appellarenmqiieu
appellarenmqiuie appellarenmqiuei appellarenmqieui appellarenmqieiu appellarenmqiiue appellarenmqiieu appellarenmqiuie
appellarenmqiuei appellarenmqieui appellarenmqieiu appellarenmquiie appellarenmquiei appellarenmquiie appellarenmquiei
appellarenmqueii appellarenmqueii appellarenmqeiui appellarenmqeiiu appellarenmqeuii appellarenmqeuii appellarenmqeiui
appellarenmqeiiu appellarenmuiqie appellarenmuiqei appellarenmuiiqe appellarenmuiieq appellarenmuieiq appellarenmuieqi
appellarenmuqiie appellarenmuqiei appellarenmuqiie appellarenmuqiei appellarenmuqeii appellarenmuqeii appellarenmuiqie
appellarenmuiqei appellarenmuiiqe appellarenmuiieq appellarenmuieiq appellarenmuieqi appellarenmueqii appellarenmueqii
appellarenmueiqi appellarenmueiiq appellarenmueiiq appellarenmueiqi appellarenmeiqui appellarenmeiqiu appellarenmeiuqi
appellarenmeiuiq appellarenmeiiuq appellarenmeiiqu appellarenmeqiui appellarenmeqiiu appellarenmequii appellarenmequii
appellarenmeqiui appellarenmeqiiu appellarenmeuqii appellarenmeuqii appellarenmeuiqi appellarenmeuiiq appellarenmeuiiq
appellarenmeuiqi appellarenmeiqui appellarenmeiqiu appellarenmeiuqi appellarenmeiuiq appellarenmeiiuq appellarenmeiiqu
appellarenimique appellarenimiqeu appellarenimiuqe appellarenimiueq appellarenimieuq appellarenimiequ appellarenimqiue
appellarenimqieu appellarenimquie appellarenimquei appellarenimqeui appellarenimqeiu appellarenimuqie appellarenimuqei
appellarenimuiqe appellarenimuieq appellarenimueiq appellarenimueqi appellarenimequi appellarenimeqiu appellarenimeuqi
appellarenimeuiq appellarenimeiuq appellarenimeiqu appellareniimque appellareniimqeu appellareniimuqe appellareniimueq
appellareniimeuq appellareniimequ appellareniiqmue appellareniiqmeu appellareniiqume appellareniiquem appellareniiqeum
appellareniiqemu appellareniiuqme appellareniiuqem appellareniiumqe appellareniiumeq appellareniiuemq appellareniiueqm
appellareniiequm appellareniieqmu appellareniieuqm appellareniieumq appellareniiemuq appellareniiemqu appellareniqimue
appellareniqimeu appellareniqiume appellareniqiuem appellareniqieum appellareniqiemu appellareniqmiue appellareniqmieu
appellareniqmuie appellareniqmuei appellareniqmeui appellareniqmeiu appellareniqumie appellareniqumei appellareniquime
appellareniquiem appellareniqueim appellareniquemi appellareniqemui appellareniqemiu appellareniqeumi appellareniqeuim
appellareniqeium appellareniqeimu appellareniuiqme appellareniuiqem appellareniuimqe appellareniuimeq appellareniuiemq
appellareniuieqm appellareniuqime appellareniuqiem appellareniuqmie appellareniuqmei appellareniuqemi appellareniuqeim
appellareniumqie appellareniumqei appellareniumiqe appellareniumieq appellareniumeiq appellareniumeqi appellareniueqmi
appellareniueqim appellareniuemqi appellareniuemiq appellareniueimq appellareniueiqm appellarenieiqum appellarenieiqmu
appellarenieiuqm appellarenieiumq appellarenieimuq appellarenieimqu appellarenieqium appellarenieqimu appellareniequim
appellareniequmi appellarenieqmui appellarenieqmiu appellarenieuqim appellarenieuqmi appellarenieuiqm appellarenieuimq
appellarenieumiq appellarenieumqi appellareniemqui appellareniemqiu appellareniemuqi appellareniemuiq appellareniemiuq
appellareniemiqu appellarenqmiiue appellarenqmiieu appellarenqmiuie appellarenqmiuei appellarenqmieui appellarenqmieiu
appellarenqmiiue appellarenqmiieu appellarenqmiuie appellarenqmiuei appellarenqmieui appellarenqmieiu appellarenqmuiie
appellarenqmuiei appellarenqmuiie appellarenqmuiei appellarenqmueii appellarenqmueii appellarenqmeiui appellarenqmeiiu
appellarenqmeuii appellarenqmeuii appellarenqmeiui appellarenqmeiiu appellarenqimiue appellarenqimieu appellarenqimuie
appellarenqimuei appellarenqimeui appellarenqimeiu appellarenqiimue appellarenqiimeu appellarenqiiume appellarenqiiuem
appellarenqiieum appellarenqiiemu appellarenqiuime appellarenqiuiem appellarenqiumie appellarenqiumei appellarenqiuemi
appellarenqiueim appellarenqieium appellarenqieimu appellarenqieuim appellarenqieumi appellarenqiemui appellarenqiemiu
appellarenqiimue appellarenqiimeu appellarenqiiume appellarenqiiuem appellarenqiieum appellarenqiiemu appellarenqimiue
appellarenqimieu appellarenqimuie appellarenqimuei appellarenqimeui appellarenqimeiu appellarenqiumie appellarenqiumei
appellarenqiuime appellarenqiuiem appellarenqiueim appellarenqiuemi appellarenqiemui appellarenqiemiu appellarenqieumi
appellarenqieuim appellarenqieium appellarenqieimu appellarenquiime appellarenquiiem appellarenquimie appellarenquimei
appellarenquiemi appellarenquieim appellarenquiime appellarenquiiem appellarenquimie appellarenquimei appellarenquiemi
appellarenquieim appellarenqumiie appellarenqumiei appellarenqumiie appellarenqumiei appellarenqumeii appellarenqumeii
appellarenqueimi appellarenqueiim appellarenquemii appellarenquemii appellarenqueimi appellarenqueiim appellarenqeiium
appellarenqeiimu appellarenqeiuim appellarenqeiumi appellarenqeimui appellarenqeimiu appellarenqeiium appellarenqeiimu
appellarenqeiuim appellarenqeiumi appellarenqeimui appellarenqeimiu appellarenqeuiim appellarenqeuimi appellarenqeuiim
appellarenqeuimi appellarenqeumii appellarenqeumii appellarenqemiui appellarenqemiiu appellarenqemuii appellarenqemuii
appellarenqemiui appellarenqemiiu appellarenumiqie appellarenumiqei appellarenumiiqe appellarenumiieq appellarenumieiq
appellarenumieqi appellarenumqiie appellarenumqiei appellarenumqiie appellarenumqiei appellarenumqeii appellarenumqeii
appellarenumiqie appellarenumiqei appellarenumiiqe appellarenumiieq appellarenumieiq appellarenumieqi appellarenumeqii
appellarenumeqii appellarenumeiqi appellarenumeiiq appellarenumeiiq appellarenumeiqi appellarenuimqie appellarenuimqei
appellarenuimiqe appellarenuimieq appellarenuimeiq appellarenuimeqi appellarenuiqmie appellarenuiqmei appellarenuiqime
appellarenuiqiem appellarenuiqeim appellarenuiqemi appellarenuiiqme appellarenuiiqem appellarenuiimqe appellarenuiimeq
appellarenuiiemq appellarenuiieqm appellarenuieqim appellarenuieqmi appellarenuieiqm appellarenuieimq appellarenuiemiq
appellarenuiemqi appellarenuqimie appellarenuqimei appellarenuqiime appellarenuqiiem appellarenuqieim appellarenuqiemi
appellarenuqmiie appellarenuqmiei appellarenuqmiie appellarenuqmiei appellarenuqmeii appellarenuqmeii appellarenuqimie
appellarenuqimei appellarenuqiime appellarenuqiiem appellarenuqieim appellarenuqiemi appellarenuqemii appellarenuqemii
appellarenuqeimi appellarenuqeiim appellarenuqeiim appellarenuqeimi appellarenuiiqme appellarenuiiqem appellarenuiimqe
appellarenuiimeq appellarenuiiemq appellarenuiieqm appellarenuiqime appellarenuiqiem appellarenuiqmie appellarenuiqmei
appellarenuiqemi appellarenuiqeim appellarenuimqie appellarenuimqei appellarenuimiqe appellarenuimieq appellarenuimeiq
appellarenuimeqi appellarenuieqmi appellarenuieqim appellarenuiemqi appellarenuiemiq appellarenuieimq appellarenuieiqm
appellarenueiqim appellarenueiqmi appellarenueiiqm appellarenueiimq appellarenueimiq appellarenueimqi appellarenueqiim
appellarenueqimi appellarenueqiim appellarenueqimi appellarenueqmii appellarenueqmii appellarenueiqim appellarenueiqmi
appellarenueiiqm appellarenueiimq appellarenueimiq appellarenueimqi appellarenuemqii appellarenuemqii appellarenuemiqi
appellarenuemiiq appellarenuemiiq appellarenuemiqi appellarenemiqui appellarenemiqiu appellarenemiuqi appellarenemiuiq
appellarenemiiuq appellarenemiiqu appellarenemqiui appellarenemqiiu appellarenemquii appellarenemquii appellarenemqiui
appellarenemqiiu appellarenemuqii appellarenemuqii appellarenemuiqi appellarenemuiiq appellarenemuiiq appellarenemuiqi
appellarenemiqui appellarenemiqiu appellarenemiuqi appellarenemiuiq appellarenemiiuq appellarenemiiqu appellareneimqui
appellareneimqiu appellareneimuqi appellareneimuiq appellareneimiuq appellareneimiqu appellareneiqmui appellareneiqmiu
appellareneiqumi appellareneiquim appellareneiqium appellareneiqimu appellareneiuqmi appellareneiuqim appellareneiumqi
appellareneiumiq appellareneiuimq appellareneiuiqm appellareneiiqum appellareneiiqmu appellareneiiuqm appellareneiiumq
appellareneiimuq appellareneiimqu appellareneqimui appellareneqimiu appellareneqiumi appellareneqiuim appellareneqiium
appellareneqiimu appellareneqmiui appellareneqmiiu appellareneqmuii appellareneqmuii appellareneqmiui appellareneqmiiu
appellarenequmii appellarenequmii appellarenequimi appellarenequiim appellarenequiim appellarenequimi appellareneqimui
appellareneqimiu appellareneqiumi appellareneqiuim appellareneqiium appellareneqiimu appellareneuiqmi appellareneuiqim
appellareneuimqi appellareneuimiq appellareneuiimq appellareneuiiqm appellareneuqimi appellareneuqiim appellareneuqmii
appellareneuqmii appellareneuqimi appellareneuqiim appellareneumqii appellareneumqii appellareneumiqi appellareneumiiq
appellareneumiiq appellareneumiqi appellareneuiqmi appellareneuiqim appellareneuimqi appellareneuimiq appellareneuiimq
appellareneuiiqm appellareneiiqum appellareneiiqmu appellareneiiuqm appellareneiiumq appellareneiimuq appellareneiimqu
appellareneiqium appellareneiqimu appellareneiquim appellareneiqumi appellareneiqmui appellareneiqmiu appellareneiuqim
appellareneiuqmi appellareneiuiqm appellareneiuimq appellareneiumiq appellareneiumqi appellareneimqui appellareneimqiu
appellareneimuqi appellareneimuiq appellareneimiuq appellareneimiqu appellareiinmque appellareiinmqeu appellareiinmuqe
appellareiinmueq appellareiinmeuq appellareiinmequ appellareiinqmue appellareiinqmeu appellareiinqume appellareiinquem
appellareiinqeum appellareiinqemu appellareiinuqme appellareiinuqem appellareiinumqe appellareiinumeq appellareiinuemq
appellareiinueqm appellareiinequm appellareiineqmu appellareiineuqm appellareiineumq appellareiinemuq appellareiinemqu
appellareiimnque appellareiimnqeu appellareiimnuqe appellareiimnueq appellareiimneuq appellareiimnequ appellareiimqnue
appellareiimqneu appellareiimqune appellareiimquen appellareiimqeun appellareiimqenu appellareiimuqne appellareiimuqen
appellareiimunqe appellareiimuneq appellareiimuenq appellareiimueqn appellareiimequn appellareiimeqnu appellareiimeuqn
appellareiimeunq appellareiimenuq appellareiimenqu appellareiiqmnue appellareiiqmneu appellareiiqmune appellareiiqmuen
appellareiiqmeun appellareiiqmenu appellareiiqnmue appellareiiqnmeu appellareiiqnume appellareiiqnuem appellareiiqneum
appellareiiqnemu appellareiiqunme appellareiiqunem appellareiiqumne appellareiiqumen appellareiiquemn appellareiiquenm
appellareiiqenum appellareiiqenmu appellareiiqeunm appellareiiqeumn appellareiiqemun appellareiiqemnu appellareiiumqne
appellareiiumqen appellareiiumnqe appellareiiumneq appellareiiumenq appellareiiumeqn appellareiiuqmne appellareiiuqmen
appellareiiuqnme appellareiiuqnem appellareiiuqenm appellareiiuqemn appellareiiunqme appellareiiunqem appellareiiunmqe
appellareiiunmeq appellareiiunemq appellareiiuneqm appellareiiueqnm appellareiiueqmn appellareiiuenqm appellareiiuenmq
appellareiiuemnq appellareiiuemqn appellareiiemqun appellareiiemqnu appellareiiemuqn appellareiiemunq appellareiiemnuq
appellareiiemnqu appellareiieqmun appellareiieqmnu appellareiiequmn appellareiiequnm appellareiieqnum appellareiieqnmu
appellareiieuqmn appellareiieuqnm appellareiieumqn appellareiieumnq appellareiieunmq appellareiieunqm appellareiienqum
appellareiienqmu appellareiienuqm appellareiienumq appellareiienmuq appellareiienmqu appellareinimque appellareinimqeu
appellareinimuqe appellareinimueq appellareinimeuq appellareinimequ appellareiniqmue appellareiniqmeu appellareiniqume
appellareiniquem appellareiniqeum appellareiniqemu appellareiniuqme appellareiniuqem appellareiniumqe appellareiniumeq
appellareiniuemq appellareiniueqm appellareiniequm appellareinieqmu appellareinieuqm appellareinieumq appellareiniemuq
appellareiniemqu appellareinmique appellareinmiqeu appellareinmiuqe appellareinmiueq appellareinmieuq appellareinmiequ
appellareinmqiue appellareinmqieu appellareinmquie appellareinmquei appellareinmqeui appellareinmqeiu appellareinmuqie
appellareinmuqei appellareinmuiqe appellareinmuieq appellareinmueiq appellareinmueqi appellareinmequi appellareinmeqiu
appellareinmeuqi appellareinmeuiq appellareinmeiuq appellareinmeiqu appellareinqmiue appellareinqmieu appellareinqmuie
appellareinqmuei appellareinqmeui appellareinqmeiu appellareinqimue appellareinqimeu appellareinqiume appellareinqiuem
appellareinqieum appellareinqiemu appellareinquime appellareinquiem appellareinqumie appellareinqumei appellareinquemi
appellareinqueim appellareinqeium appellareinqeimu appellareinqeuim appellareinqeumi appellareinqemui appellareinqemiu
appellareinumqie appellareinumqei appellareinumiqe appellareinumieq appellareinumeiq appellareinumeqi appellareinuqmie
appellareinuqmei appellareinuqime appellareinuqiem appellareinuqeim appellareinuqemi appellareinuiqme appellareinuiqem
appellareinuimqe appellareinuimeq appellareinuiemq appellareinuieqm appellareinueqim appellareinueqmi appellareinueiqm
appellareinueimq appellareinuemiq appellareinuemqi appellareinemqui appellareinemqiu appellareinemuqi appellareinemuiq
appellareinemiuq appellareinemiqu appellareineqmui appellareineqmiu appellareinequmi appellareinequim appellareineqium
appellareineqimu appellareineuqmi appellareineuqim appellareineumqi appellareineumiq appellareineuimq appellareineuiqm
appellareineiqum appellareineiqmu appellareineiuqm appellareineiumq appellareineimuq appellareineimqu appellareimnique
appellareimniqeu appellareimniuqe appellareimniueq appellareimnieuq appellareimniequ appellareimnqiue appellareimnqieu
appellareimnquie appellareimnquei appellareimnqeui appellareimnqeiu appellareimnuqie appellareimnuqei appellareimnuiqe
appellareimnuieq appellareimnueiq appellareimnueqi appellareimnequi appellareimneqiu appellareimneuqi appellareimneuiq
appellareimneiuq appellareimneiqu appellareiminque appellareiminqeu appellareiminuqe appellareiminueq appellareimineuq
appellareiminequ appellareimiqnue appellareimiqneu appellareimiqune appellareimiquen appellareimiqeun appellareimiqenu
appellareimiuqne appellareimiuqen appellareimiunqe appellareimiuneq appellareimiuenq appellareimiueqn appellareimiequn
appellareimieqnu appellareimieuqn appellareimieunq appellareimienuq appellareimienqu appellareimqinue appellareimqineu
appellareimqiune appellareimqiuen appellareimqieun appellareimqienu appellareimqniue appellareimqnieu appellareimqnuie
appellareimqnuei appellareimqneui appellareimqneiu appellareimqunie appellareimqunei appellareimquine appellareimquien
appellareimquein appellareimqueni appellareimqenui appellareimqeniu appellareimqeuni appellareimqeuin appellareimqeiun
appellareimqeinu appellareimuiqne appellareimuiqen appellareimuinqe appellareimuineq appellareimuienq appellareimuieqn
appellareimuqine appellareimuqien appellareimuqnie appellareimuqnei appellareimuqeni appellareimuqein appellareimunqie
appellareimunqei appellareimuniqe appellareimunieq appellareimuneiq appellareimuneqi appellareimueqni appellareimueqin
appellareimuenqi appellareimueniq appellareimueinq appellareimueiqn appellareimeiqun appellareimeiqnu appellareimeiuqn
appellareimeiunq appellareimeinuq appellareimeinqu appellareimeqiun appellareimeqinu appellareimequin appellareimequni
appellareimeqnui appellareimeqniu appellareimeuqin appellareimeuqni appellareimeuiqn appellareimeuinq appellareimeuniq
appellareimeunqi appellareimenqui appellareimenqiu appellareimenuqi appellareimenuiq appellareimeniuq appellareimeniqu
appellareiqnmiue appellareiqnmieu appellareiqnmuie appellareiqnmuei appellareiqnmeui appellareiqnmeiu appellareiqnimue
appellareiqnimeu appellareiqniume appellareiqniuem appellareiqnieum appellareiqniemu appellareiqnuime appellareiqnuiem
appellareiqnumie appellareiqnumei appellareiqnuemi appellareiqnueim appellareiqneium appellareiqneimu appellareiqneuim
appellareiqneumi appellareiqnemui appellareiqnemiu appellareiqmniue appellareiqmnieu appellareiqmnuie appellareiqmnuei
appellareiqmneui appellareiqmneiu appellareiqminue appellareiqmineu appellareiqmiune appellareiqmiuen appellareiqmieun
appellareiqmienu appellareiqmuine appellareiqmuien appellareiqmunie appellareiqmunei appellareiqmueni appellareiqmuein
appellareiqmeiun appellareiqmeinu appellareiqmeuin appellareiqmeuni appellareiqmenui appellareiqmeniu appellareiqimnue
appellareiqimneu appellareiqimune appellareiqimuen appellareiqimeun appellareiqimenu appellareiqinmue appellareiqinmeu
appellareiqinume appellareiqinuem appellareiqineum appellareiqinemu appellareiqiunme appellareiqiunem appellareiqiumne
appellareiqiumen appellareiqiuemn appellareiqiuenm appellareiqienum appellareiqienmu appellareiqieunm appellareiqieumn
appellareiqiemun appellareiqiemnu appellareiqumine appellareiqumien appellareiqumnie appellareiqumnei appellareiqumeni
appellareiqumein appellareiquimne appellareiquimen appellareiquinme appellareiquinem appellareiquienm appellareiquiemn
appellareiqunime appellareiquniem appellareiqunmie appellareiqunmei appellareiqunemi appellareiquneim appellareiqueinm
appellareiqueimn appellareiquenim appellareiquenmi appellareiquemni appellareiquemin appellareiqemiun appellareiqeminu
appellareiqemuin appellareiqemuni appellareiqemnui appellareiqemniu appellareiqeimun appellareiqeimnu appellareiqeiumn
appellareiqeiunm appellareiqeinum appellareiqeinmu appellareiqeuimn appellareiqeuinm appellareiqeumin appellareiqeumni
appellareiqeunmi appellareiqeunim appellareiqenium appellareiqenimu appellareiqenuim appellareiqenumi appellareiqenmui
appellareiqenmiu appellareiunmqie appellareiunmqei appellareiunmiqe appellareiunmieq appellareiunmeiq appellareiunmeqi
appellareiunqmie appellareiunqmei appellareiunqime appellareiunqiem appellareiunqeim appellareiunqemi appellareiuniqme
appellareiuniqem appellareiunimqe appellareiunimeq appellareiuniemq appellareiunieqm appellareiuneqim appellareiuneqmi
appellareiuneiqm appellareiuneimq appellareiunemiq appellareiunemqi appellareiumnqie appellareiumnqei appellareiumniqe
appellareiumnieq appellareiumneiq appellareiumneqi appellareiumqnie appellareiumqnei appellareiumqine appellareiumqien
appellareiumqein appellareiumqeni appellareiumiqne appellareiumiqen appellareiuminqe appellareiumineq appellareiumienq
appellareiumieqn appellareiumeqin appellareiumeqni appellareiumeiqn appellareiumeinq appellareiumeniq appellareiumenqi
appellareiuqmnie appellareiuqmnei appellareiuqmine appellareiuqmien appellareiuqmein appellareiuqmeni appellareiuqnmie
appellareiuqnmei appellareiuqnime appellareiuqniem appellareiuqneim appellareiuqnemi appellareiuqinme appellareiuqinem
appellareiuqimne appellareiuqimen appellareiuqiemn appellareiuqienm appellareiuqenim appellareiuqenmi appellareiuqeinm
appellareiuqeimn appellareiuqemin appellareiuqemni appellareiuimqne appellareiuimqen appellareiuimnqe appellareiuimneq
appellareiuimenq appellareiuimeqn appellareiuiqmne appellareiuiqmen appellareiuiqnme appellareiuiqnem appellareiuiqenm
appellareiuiqemn appellareiuinqme appellareiuinqem appellareiuinmqe appellareiuinmeq appellareiuinemq appellareiuineqm
appellareiuieqnm appellareiuieqmn appellareiuienqm appellareiuienmq appellareiuiemnq appellareiuiemqn appellareiuemqin
appellareiuemqni appellareiuemiqn appellareiueminq appellareiuemniq appellareiuemnqi appellareiueqmin appellareiueqmni
appellareiueqimn appellareiueqinm appellareiueqnim appellareiueqnmi appellareiueiqmn appellareiueiqnm appellareiueimqn
appellareiueimnq appellareiueinmq appellareiueinqm appellareiuenqim appellareiuenqmi appellareiueniqm appellareiuenimq
appellareiuenmiq appellareiuenmqi appellareienmqui appellareienmqiu appellareienmuqi appellareienmuiq appellareienmiuq
appellareienmiqu appellareienqmui appellareienqmiu appellareienqumi appellareienquim appellareienqium appellareienqimu
appellareienuqmi appellareienuqim appellareienumqi appellareienumiq appellareienuimq appellareienuiqm appellareieniqum
appellareieniqmu appellareieniuqm appellareieniumq appellareienimuq appellareienimqu appellareiemnqui appellareiemnqiu
appellareiemnuqi appellareiemnuiq appellareiemniuq appellareiemniqu appellareiemqnui appellareiemqniu appellareiemquni
appellareiemquin appellareiemqiun appellareiemqinu appellareiemuqni appellareiemuqin appellareiemunqi appellareiemuniq
appellareiemuinq appellareiemuiqn appellareiemiqun appellareiemiqnu appellareiemiuqn appellareiemiunq appellareieminuq
appellareieminqu appellareieqmnui appellareieqmniu appellareieqmuni appellareieqmuin appellareieqmiun appellareieqminu
appellareieqnmui appellareieqnmiu appellareieqnumi appellareieqnuim appellareieqnium appellareieqnimu appellareiequnmi
appellareiequnim appellareiequmni appellareiequmin appellareiequimn appellareiequinm appellareieqinum appellareieqinmu
appellareieqiunm appellareieqiumn appellareieqimun appellareieqimnu appellareieumqni appellareieumqin appellareieumnqi
appellareieumniq appellareieuminq appellareieumiqn appellareieuqmni appellareieuqmin appellareieuqnmi appellareieuqnim
appellareieuqinm appellareieuqimn appellareieunqmi appellareieunqim appellareieunmqi appellareieunmiq appellareieunimq
appellareieuniqm appellareieuiqnm appellareieuiqmn appellareieuinqm appellareieuinmq appellareieuimnq appellareieuimqn
appellareieimqun appellareieimqnu appellareieimuqn appellareieimunq appellareieimnuq appellareieimnqu appellareieiqmun
appellareieiqmnu appellareieiqumn appellareieiqunm appellareieiqnum appellareieiqnmu appellareieiuqmn appellareieiuqnm
appellareieiumqn appellareieiumnq appellareieiunmq appellareieiunqm appellareieinqum appellareieinqmu appellareieinuqm
appellareieinumq appellareieinmuq appellareieinmqu appellareqinimue appellareqinimeu appellareqiniume appellareqiniuem
appellareqinieum appellareqiniemu appellareqinmiue appellareqinmieu appellareqinmuie appellareqinmuei appellareqinmeui
appellareqinmeiu appellareqinumie appellareqinumei appellareqinuime appellareqinuiem appellareqinueim appellareqinuemi
appellareqinemui appellareqinemiu appellareqineumi appellareqineuim appellareqineium appellareqineimu appellareqiinmue
appellareqiinmeu appellareqiinume appellareqiinuem appellareqiineum appellareqiinemu appellareqiimnue appellareqiimneu
appellareqiimune appellareqiimuen appellareqiimeun appellareqiimenu appellareqiiumne appellareqiiumen appellareqiiunme
appellareqiiunem appellareqiiuenm appellareqiiuemn appellareqiiemun appellareqiiemnu appellareqiieumn appellareqiieunm
appellareqiienum appellareqiienmu appellareqiminue appellareqimineu appellareqimiune appellareqimiuen appellareqimieun
appellareqimienu appellareqimniue appellareqimnieu appellareqimnuie appellareqimnuei appellareqimneui appellareqimneiu
appellareqimunie appellareqimunei appellareqimuine appellareqimuien appellareqimuein appellareqimueni appellareqimenui
appellareqimeniu appellareqimeuni appellareqimeuin appellareqimeiun appellareqimeinu appellareqiuimne appellareqiuimen
appellareqiuinme appellareqiuinem appellareqiuienm appellareqiuiemn appellareqiumine appellareqiumien appellareqiumnie
appellareqiumnei appellareqiumeni appellareqiumein appellareqiunmie appellareqiunmei appellareqiunime appellareqiuniem
appellareqiuneim appellareqiunemi appellareqiuemni appellareqiuemin appellareqiuenmi appellareqiuenim appellareqiueinm
appellareqiueimn appellareqieimun appellareqieimnu appellareqieiumn appellareqieiunm appellareqieinum appellareqieinmu
appellareqiemiun appellareqieminu appellareqiemuin appellareqiemuni appellareqiemnui appellareqiemniu appellareqieumin
appellareqieumni appellareqieuimn appellareqieuinm appellareqieunim appellareqieunmi appellareqienmui appellareqienmiu
appellareqienumi appellareqienuim appellareqienium appellareqienimu appellareqniimue appellareqniimeu appellareqniiume
appellareqniiuem appellareqniieum appellareqniiemu appellareqnimiue appellareqnimieu appellareqnimuie appellareqnimuei
appellareqnimeui appellareqnimeiu appellareqniumie appellareqniumei appellareqniuime appellareqniuiem appellareqniueim
appellareqniuemi appellareqniemui appellareqniemiu appellareqnieumi appellareqnieuim appellareqnieium appellareqnieimu
appellareqniimue appellareqniimeu appellareqniiume appellareqniiuem appellareqniieum appellareqniiemu appellareqnimiue
appellareqnimieu appellareqnimuie appellareqnimuei appellareqnimeui appellareqnimeiu appellareqniumie appellareqniumei
appellareqniuime appellareqniuiem appellareqniueim appellareqniuemi appellareqniemui appellareqniemiu appellareqnieumi
appellareqnieuim appellareqnieium appellareqnieimu appellareqnmiiue appellareqnmiieu appellareqnmiuie appellareqnmiuei
appellareqnmieui appellareqnmieiu appellareqnmiiue appellareqnmiieu appellareqnmiuie appellareqnmiuei appellareqnmieui
appellareqnmieiu appellareqnmuiie appellareqnmuiei appellareqnmuiie appellareqnmuiei appellareqnmueii appellareqnmueii
appellareqnmeiui appellareqnmeiiu appellareqnmeuii appellareqnmeuii appellareqnmeiui appellareqnmeiiu appellareqnuimie
appellareqnuimei appellareqnuiime appellareqnuiiem appellareqnuieim appellareqnuiemi appellareqnumiie appellareqnumiei
appellareqnumiie appellareqnumiei appellareqnumeii appellareqnumeii appellareqnuimie appellareqnuimei appellareqnuiime
appellareqnuiiem appellareqnuieim appellareqnuiemi appellareqnuemii appellareqnuemii appellareqnueimi appellareqnueiim
appellareqnueiim appellareqnueimi appellareqneimui appellareqneimiu appellareqneiumi appellareqneiuim appellareqneiium
appellareqneiimu appellareqnemiui appellareqnemiiu appellareqnemuii appellareqnemuii appellareqnemiui appellareqnemiiu
appellareqneumii appellareqneumii appellareqneuimi appellareqneuiim appellareqneuiim appellareqneuimi appellareqneimui
appellareqneimiu appellareqneiumi appellareqneiuim appellareqneiium appellareqneiimu appellareqinimue appellareqinimeu
appellareqiniume appellareqiniuem appellareqinieum appellareqiniemu appellareqinmiue appellareqinmieu appellareqinmuie
appellareqinmuei appellareqinmeui appellareqinmeiu appellareqinumie appellareqinumei appellareqinuime appellareqinuiem
appellareqinueim appellareqinuemi appellareqinemui appellareqinemiu appellareqineumi appellareqineuim appellareqineium
appellareqineimu appellareqiinmue appellareqiinmeu appellareqiinume appellareqiinuem appellareqiineum appellareqiinemu
appellareqiimnue appellareqiimneu appellareqiimune appellareqiimuen appellareqiimeun appellareqiimenu appellareqiiumne
appellareqiiumen appellareqiiunme appellareqiiunem appellareqiiuenm appellareqiiuemn appellareqiiemun appellareqiiemnu
appellareqiieumn appellareqiieunm appellareqiienum appellareqiienmu appellareqiminue appellareqimineu appellareqimiune
appellareqimiuen appellareqimieun appellareqimienu appellareqimniue appellareqimnieu appellareqimnuie appellareqimnuei
appellareqimneui appellareqimneiu appellareqimunie appellareqimunei appellareqimuine appellareqimuien appellareqimuein
appellareqimueni appellareqimenui appellareqimeniu appellareqimeuni appellareqimeuin appellareqimeiun appellareqimeinu
appellareqiuimne appellareqiuimen appellareqiuinme appellareqiuinem appellareqiuienm appellareqiuiemn appellareqiumine
appellareqiumien appellareqiumnie appellareqiumnei appellareqiumeni appellareqiumein appellareqiunmie appellareqiunmei
appellareqiunime appellareqiuniem appellareqiuneim appellareqiunemi appellareqiuemni appellareqiuemin appellareqiuenmi
appellareqiuenim appellareqiueinm appellareqiueimn appellareqieimun appellareqieimnu appellareqieiumn appellareqieiunm
appellareqieinum appellareqieinmu appellareqiemiun appellareqieminu appellareqiemuin appellareqiemuni appellareqiemnui
appellareqiemniu appellareqieumin appellareqieumni appellareqieuimn appellareqieuinm appellareqieunim appellareqieunmi
appellareqienmui appellareqienmiu appellareqienumi appellareqienuim appellareqienium appellareqienimu appellareqmniiue
appellareqmniieu appellareqmniuie appellareqmniuei appellareqmnieui appellareqmnieiu appellareqmniiue appellareqmniieu
appellareqmniuie appellareqmniuei appellareqmnieui appellareqmnieiu appellareqmnuiie appellareqmnuiei appellareqmnuiie
appellareqmnuiei appellareqmnueii appellareqmnueii appellareqmneiui appellareqmneiiu appellareqmneuii appellareqmneuii
appellareqmneiui appellareqmneiiu appellareqminiue appellareqminieu appellareqminuie appellareqminuei appellareqmineui
appellareqmineiu appellareqmiinue appellareqmiineu appellareqmiiune appellareqmiiuen appellareqmiieun appellareqmiienu
appellareqmiuine appellareqmiuien appellareqmiunie appellareqmiunei appellareqmiueni appellareqmiuein appellareqmieiun
appellareqmieinu appellareqmieuin appellareqmieuni appellareqmienui appellareqmieniu appellareqmiinue appellareqmiineu
appellareqmiiune appellareqmiiuen appellareqmiieun appellareqmiienu appellareqminiue appellareqminieu appellareqminuie
appellareqminuei appellareqmineui appellareqmineiu appellareqmiunie appellareqmiunei appellareqmiuine appellareqmiuien
appellareqmiuein appellareqmiueni appellareqmienui appellareqmieniu appellareqmieuni appellareqmieuin appellareqmieiun
appellareqmieinu appellareqmuiine appellareqmuiien appellareqmuinie appellareqmuinei appellareqmuieni appellareqmuiein
appellareqmuiine appellareqmuiien appellareqmuinie appellareqmuinei appellareqmuieni appellareqmuiein appellareqmuniie
appellareqmuniei appellareqmuniie appellareqmuniei appellareqmuneii appellareqmuneii appellareqmueini appellareqmueiin
appellareqmuenii appellareqmuenii appellareqmueini appellareqmueiin appellareqmeiiun appellareqmeiinu appellareqmeiuin
appellareqmeiuni appellareqmeinui appellareqmeiniu appellareqmeiiun appellareqmeiinu appellareqmeiuin appellareqmeiuni
appellareqmeinui appellareqmeiniu appellareqmeuiin appellareqmeuini appellareqmeuiin appellareqmeuini appellareqmeunii
appellareqmeunii appellareqmeniui appellareqmeniiu appellareqmenuii appellareqmenuii appellareqmeniui appellareqmeniiu
appellarequnimie appellarequnimei appellarequniime appellarequniiem appellarequnieim appellarequniemi appellarequnmiie
appellarequnmiei appellarequnmiie appellarequnmiei appellarequnmeii appellarequnmeii appellarequnimie appellarequnimei
appellarequniime appellarequniiem appellarequnieim appellarequniemi appellarequnemii appellarequnemii appellarequneimi
appellarequneiim appellarequneiim appellarequneimi appellarequinmie appellarequinmei appellarequinime appellarequiniem
appellarequineim appellarequinemi appellarequimnie appellarequimnei appellarequimine appellarequimien appellarequimein
appellarequimeni appellarequiimne appellarequiimen appellarequiinme appellarequiinem appellarequiienm appellarequiiemn
appellarequiemin appellarequiemni appellarequieimn appellarequieinm appellarequienim appellarequienmi appellarequminie
appellarequminei appellarequmiine appellarequmiien appellarequmiein appellarequmieni appellarequmniie appellarequmniei
appellarequmniie appellarequmniei appellarequmneii appellarequmneii appellarequminie appellarequminei appellarequmiine
appellarequmiien appellarequmiein appellarequmieni appellarequmenii appellarequmenii appellarequmeini appellarequmeiin
appellarequmeiin appellarequmeini appellarequiimne appellarequiimen appellarequiinme appellarequiinem appellarequiienm
appellarequiiemn appellarequimine appellarequimien appellarequimnie appellarequimnei appellarequimeni appellarequimein
appellarequinmie appellarequinmei appellarequinime appellarequiniem appellarequineim appellarequinemi appellarequiemni
appellarequiemin appellarequienmi appellarequienim appellarequieinm appellarequieimn appellarequeimin appellarequeimni
appellarequeiimn appellarequeiinm appellarequeinim appellarequeinmi appellarequemiin appellarequemini appellarequemiin
appellarequemini appellarequemnii appellarequemnii appellarequeimin appellarequeimni appellarequeiimn appellarequeiinm
appellarequeinim appellarequeinmi appellarequenmii appellarequenmii appellarequenimi appellarequeniim appellarequeniim
appellarequenimi appellareqenimui appellareqenimiu appellareqeniumi appellareqeniuim appellareqeniium appellareqeniimu
appellareqenmiui appellareqenmiiu appellareqenmuii appellareqenmuii appellareqenmiui appellareqenmiiu appellareqenumii
appellareqenumii appellareqenuimi appellareqenuiim appellareqenuiim appellareqenuimi appellareqenimui appellareqenimiu
appellareqeniumi appellareqeniuim appellareqeniium appellareqeniimu appellareqeinmui appellareqeinmiu appellareqeinumi
appellareqeinuim appellareqeinium appellareqeinimu appellareqeimnui appellareqeimniu appellareqeimuni appellareqeimuin
appellareqeimiun appellareqeiminu appellareqeiumni appellareqeiumin appellareqeiunmi appellareqeiunim appellareqeiuinm
appellareqeiuimn appellareqeiimun appellareqeiimnu appellareqeiiumn appellareqeiiunm appellareqeiinum appellareqeiinmu
appellareqeminui appellareqeminiu appellareqemiuni appellareqemiuin appellareqemiiun appellareqemiinu appellareqemniui
appellareqemniiu appellareqemnuii appellareqemnuii appellareqemniui appellareqemniiu appellareqemunii appellareqemunii
appellareqemuini appellareqemuiin appellareqemuiin appellareqemuini appellareqeminui appellareqeminiu appellareqemiuni
appellareqemiuin appellareqemiiun appellareqemiinu appellareqeuimni appellareqeuimin appellareqeuinmi appellareqeuinim
appellareqeuiinm appellareqeuiimn appellareqeumini appellareqeumiin appellareqeumnii appellareqeumnii appellareqeumini
appellareqeumiin appellareqeunmii appellareqeunmii appellareqeunimi appellareqeuniim appellareqeuniim appellareqeunimi
appellareqeuimni appellareqeuimin appellareqeuinmi appellareqeuinim appellareqeuiinm appellareqeuiimn appellareqeiimun
appellareqeiimnu appellareqeiiumn appellareqeiiunm appellareqeiinum appellareqeiinmu appellareqeimiun appellareqeiminu
appellareqeimuin appellareqeimuni appellareqeimnui appellareqeimniu appellareqeiumin appellareqeiumni appellareqeiuimn
appellareqeiuinm appellareqeiunim appellareqeiunmi appellareqeinmui appellareqeinmiu appellareqeinumi appellareqeinuim
appellareqeinium appellareqeinimu appellareuiniqme appellareuiniqem appellareuinimqe appellareuinimeq appellareuiniemq
appellareuinieqm appellareuinqime appellareuinqiem appellareuinqmie appellareuinqmei appellareuinqemi appellareuinqeim
appellareuinmqie appellareuinmqei appellareuinmiqe appellareuinmieq appellareuinmeiq appellareuinmeqi appellareuineqmi
appellareuineqim appellareuinemqi appellareuinemiq appellareuineimq appellareuineiqm appellareuiinqme appellareuiinqem
appellareuiinmqe appellareuiinmeq appellareuiinemq appellareuiineqm appellareuiiqnme appellareuiiqnem appellareuiiqmne
appellareuiiqmen appellareuiiqemn appellareuiiqenm appellareuiimqne appellareuiimqen appellareuiimnqe appellareuiimneq
appellareuiimenq appellareuiimeqn appellareuiieqmn appellareuiieqnm appellareuiiemqn appellareuiiemnq appellareuiienmq
appellareuiienqm appellareuiqinme appellareuiqinem appellareuiqimne appellareuiqimen appellareuiqiemn appellareuiqienm
appellareuiqnime appellareuiqniem appellareuiqnmie appellareuiqnmei appellareuiqnemi appellareuiqneim appellareuiqmnie
appellareuiqmnei appellareuiqmine appellareuiqmien appellareuiqmein appellareuiqmeni appellareuiqenmi appellareuiqenim
appellareuiqemni appellareuiqemin appellareuiqeimn appellareuiqeinm appellareuimiqne appellareuimiqen appellareuiminqe
appellareuimineq appellareuimienq appellareuimieqn appellareuimqine appellareuimqien appellareuimqnie appellareuimqnei
appellareuimqeni appellareuimqein appellareuimnqie appellareuimnqei appellareuimniqe appellareuimnieq appellareuimneiq
appellareuimneqi appellareuimeqni appellareuimeqin appellareuimenqi appellareuimeniq appellareuimeinq appellareuimeiqn
appellareuieiqmn appellareuieiqnm appellareuieimqn appellareuieimnq appellareuieinmq appellareuieinqm appellareuieqimn
appellareuieqinm appellareuieqmin appellareuieqmni appellareuieqnmi appellareuieqnim appellareuiemqin appellareuiemqni
appellareuiemiqn appellareuieminq appellareuiemniq appellareuiemnqi appellareuienqmi appellareuienqim appellareuienmqi
appellareuienmiq appellareuienimq appellareuieniqm appellareuniiqme appellareuniiqem appellareuniimqe appellareuniimeq
appellareuniiemq appellareuniieqm appellareuniqime appellareuniqiem appellareuniqmie appellareuniqmei appellareuniqemi
appellareuniqeim appellareunimqie appellareunimqei appellareunimiqe appellareunimieq appellareunimeiq appellareunimeqi
appellareunieqmi appellareunieqim appellareuniemqi appellareuniemiq appellareunieimq appellareunieiqm appellareuniiqme
appellareuniiqem appellareuniimqe appellareuniimeq appellareuniiemq appellareuniieqm appellareuniqime appellareuniqiem
appellareuniqmie appellareuniqmei appellareuniqemi appellareuniqeim appellareunimqie appellareunimqei appellareunimiqe
appellareunimieq appellareunimeiq appellareunimeqi appellareunieqmi appellareunieqim appellareuniemqi appellareuniemiq
appellareunieimq appellareunieiqm appellareunqiime appellareunqiiem appellareunqimie appellareunqimei appellareunqiemi
appellareunqieim appellareunqiime appellareunqiiem appellareunqimie appellareunqimei appellareunqiemi appellareunqieim
appellareunqmiie appellareunqmiei appellareunqmiie appellareunqmiei appellareunqmeii appellareunqmeii appellareunqeimi
appellareunqeiim appellareunqemii appellareunqemii appellareunqeimi appellareunqeiim appellareunmiqie appellareunmiqei
appellareunmiiqe appellareunmiieq appellareunmieiq appellareunmieqi appellareunmqiie appellareunmqiei appellareunmqiie
appellareunmqiei appellareunmqeii appellareunmqeii appellareunmiqie appellareunmiqei appellareunmiiqe appellareunmiieq
appellareunmieiq appellareunmieqi appellareunmeqii appellareunmeqii appellareunmeiqi appellareunmeiiq appellareunmeiiq
appellareunmeiqi appellareuneiqmi appellareuneiqim appellareuneimqi appellareuneimiq appellareuneiimq appellareuneiiqm
appellareuneqimi appellareuneqiim appellareuneqmii appellareuneqmii appellareuneqimi appellareuneqiim appellareunemqii
appellareunemqii appellareunemiqi appellareunemiiq appellareunemiiq appellareunemiqi appellareuneiqmi appellareuneiqim
appellareuneimqi appellareuneimiq appellareuneiimq appellareuneiiqm appellareuiniqme appellareuiniqem appellareuinimqe
appellareuinimeq appellareuiniemq appellareuinieqm appellareuinqime appellareuinqiem appellareuinqmie appellareuinqmei
appellareuinqemi appellareuinqeim appellareuinmqie appellareuinmqei appellareuinmiqe appellareuinmieq appellareuinmeiq
appellareuinmeqi appellareuineqmi appellareuineqim appellareuinemqi appellareuinemiq appellareuineimq appellareuineiqm
appellareuiinqme appellareuiinqem appellareuiinmqe appellareuiinmeq appellareuiinemq appellareuiineqm appellareuiiqnme
appellareuiiqnem appellareuiiqmne appellareuiiqmen appellareuiiqemn appellareuiiqenm appellareuiimqne appellareuiimqen
appellareuiimnqe appellareuiimneq appellareuiimenq appellareuiimeqn appellareuiieqmn appellareuiieqnm appellareuiiemqn
appellareuiiemnq appellareuiienmq appellareuiienqm appellareuiqinme appellareuiqinem appellareuiqimne appellareuiqimen
appellareuiqiemn appellareuiqienm appellareuiqnime appellareuiqniem appellareuiqnmie appellareuiqnmei appellareuiqnemi
appellareuiqneim appellareuiqmnie appellareuiqmnei appellareuiqmine appellareuiqmien appellareuiqmein appellareuiqmeni
appellareuiqenmi appellareuiqenim appellareuiqemni appellareuiqemin appellareuiqeimn appellareuiqeinm appellareuimiqne
appellareuimiqen appellareuiminqe appellareuimineq appellareuimienq appellareuimieqn appellareuimqine appellareuimqien
appellareuimqnie appellareuimqnei appellareuimqeni appellareuimqein appellareuimnqie appellareuimnqei appellareuimniqe
appellareuimnieq appellareuimneiq appellareuimneqi appellareuimeqni appellareuimeqin appellareuimenqi appellareuimeniq
appellareuimeinq appellareuimeiqn appellareuieiqmn appellareuieiqnm appellareuieimqn appellareuieimnq appellareuieinmq
appellareuieinqm appellareuieqimn appellareuieqinm appellareuieqmin appellareuieqmni appellareuieqnmi appellareuieqnim
appellareuiemqin appellareuiemqni appellareuiemiqn appellareuieminq appellareuiemniq appellareuiemnqi appellareuienqmi
appellareuienqim appellareuienmqi appellareuienmiq appellareuienimq appellareuieniqm appellareuqniime appellareuqniiem
appellareuqnimie appellareuqnimei appellareuqniemi appellareuqnieim appellareuqniime appellareuqniiem appellareuqnimie
appellareuqnimei appellareuqniemi appellareuqnieim appellareuqnmiie appellareuqnmiei appellareuqnmiie appellareuqnmiei
appellareuqnmeii appellareuqnmeii appellareuqneimi appellareuqneiim appellareuqnemii appellareuqnemii appellareuqneimi
appellareuqneiim appellareuqinime appellareuqiniem appellareuqinmie appellareuqinmei appellareuqinemi appellareuqineim
appellareuqiinme appellareuqiinem appellareuqiimne appellareuqiimen appellareuqiiemn appellareuqiienm appellareuqimine
appellareuqimien appellareuqimnie appellareuqimnei appellareuqimeni appellareuqimein appellareuqieimn appellareuqieinm
appellareuqiemin appellareuqiemni appellareuqienmi appellareuqienim appellareuqiinme appellareuqiinem appellareuqiimne
appellareuqiimen appellareuqiiemn appellareuqiienm appellareuqinime appellareuqiniem appellareuqinmie appellareuqinmei
appellareuqinemi appellareuqineim appellareuqimnie appellareuqimnei appellareuqimine appellareuqimien appellareuqimein
appellareuqimeni appellareuqienmi appellareuqienim appellareuqiemni appellareuqiemin appellareuqieimn appellareuqieinm
appellareuqmiine appellareuqmiien appellareuqminie appellareuqminei appellareuqmieni appellareuqmiein appellareuqmiine
appellareuqmiien appellareuqminie appellareuqminei appellareuqmieni appellareuqmiein appellareuqmniie appellareuqmniei
appellareuqmniie appellareuqmniei appellareuqmneii appellareuqmneii appellareuqmeini appellareuqmeiin appellareuqmenii
appellareuqmenii appellareuqmeini appellareuqmeiin appellareuqeiimn appellareuqeiinm appellareuqeimin appellareuqeimni
appellareuqeinmi appellareuqeinim appellareuqeiimn appellareuqeiinm appellareuqeimin appellareuqeimni appellareuqeinmi
appellareuqeinim appellareuqemiin appellareuqemini appellareuqemiin appellareuqemini appellareuqemnii appellareuqemnii
appellareuqenimi appellareuqeniim appellareuqenmii appellareuqenmii appellareuqenimi appellareuqeniim appellareumniqie
appellareumniqei appellareumniiqe appellareumniieq appellareumnieiq appellareumnieqi appellareumnqiie appellareumnqiei
appellareumnqiie appellareumnqiei appellareumnqeii appellareumnqeii appellareumniqie appellareumniqei appellareumniiqe
appellareumniieq appellareumnieiq appellareumnieqi appellareumneqii appellareumneqii appellareumneiqi appellareumneiiq
appellareumneiiq appellareumneiqi appellareuminqie appellareuminqei appellareuminiqe appellareuminieq appellareumineiq
appellareumineqi appellareumiqnie appellareumiqnei appellareumiqine appellareumiqien appellareumiqein appellareumiqeni
appellareumiiqne appellareumiiqen appellareumiinqe appellareumiineq appellareumiienq appellareumiieqn appellareumieqin
appellareumieqni appellareumieiqn appellareumieinq appellareumieniq appellareumienqi appellareumqinie appellareumqinei
appellareumqiine appellareumqiien appellareumqiein appellareumqieni appellareumqniie appellareumqniei appellareumqniie
appellareumqniei appellareumqneii appellareumqneii appellareumqinie appellareumqinei appellareumqiine appellareumqiien
appellareumqiein appellareumqieni appellareumqenii appellareumqenii appellareumqeini appellareumqeiin appellareumqeiin
appellareumqeini appellareumiiqne appellareumiiqen appellareumiinqe appellareumiineq appellareumiienq appellareumiieqn
appellareumiqine appellareumiqien appellareumiqnie appellareumiqnei appellareumiqeni appellareumiqein appellareuminqie
appellareuminqei appellareuminiqe appellareuminieq appellareumineiq appellareumineqi appellareumieqni appellareumieqin
appellareumienqi appellareumieniq appellareumieinq appellareumieiqn appellareumeiqin appellareumeiqni appellareumeiiqn
appellareumeiinq appellareumeiniq appellareumeinqi appellareumeqiin appellareumeqini appellareumeqiin appellareumeqini
appellareumeqnii appellareumeqnii appellareumeiqin appellareumeiqni appellareumeiiqn appellareumeiinq appellareumeiniq
appellareumeinqi appellareumenqii appellareumenqii appellareumeniqi appellareumeniiq appellareumeniiq appellareumeniqi
appellareueniqmi appellareueniqim appellareuenimqi appellareuenimiq appellareueniimq appellareueniiqm appellareuenqimi
appellareuenqiim appellareuenqmii appellareuenqmii appellareuenqimi appellareuenqiim appellareuenmqii appellareuenmqii
appellareuenmiqi appellareuenmiiq appellareuenmiiq appellareuenmiqi appellareueniqmi appellareueniqim appellareuenimqi
appellareuenimiq appellareueniimq appellareueniiqm appellareueinqmi appellareueinqim appellareueinmqi appellareueinmiq
appellareueinimq appellareueiniqm appellareueiqnmi appellareueiqnim appellareueiqmni appellareueiqmin appellareueiqimn
appellareueiqinm appellareueimqni appellareueimqin appellareueimnqi appellareueimniq appellareueiminq appellareueimiqn
appellareueiiqmn appellareueiiqnm appellareueiimqn appellareueiimnq appellareueiinmq appellareueiinqm appellareueqinmi
appellareueqinim appellareueqimni appellareueqimin appellareueqiimn appellareueqiinm appellareueqnimi appellareueqniim
appellareueqnmii appellareueqnmii appellareueqnimi appellareueqniim appellareueqmnii appellareueqmnii appellareueqmini
appellareueqmiin appellareueqmiin appellareueqmini appellareueqinmi appellareueqinim appellareueqimni appellareueqimin
appellareueqiimn appellareueqiinm appellareuemiqni appellareuemiqin appellareueminqi appellareueminiq appellareuemiinq
appellareuemiiqn appellareuemqini appellareuemqiin appellareuemqnii appellareuemqnii appellareuemqini appellareuemqiin
appellareuemnqii appellareuemnqii appellareuemniqi appellareuemniiq appellareuemniiq appellareuemniqi appellareuemiqni
appellareuemiqin appellareueminqi appellareueminiq appellareuemiinq appellareuemiiqn appellareueiiqmn appellareueiiqnm
appellareueiimqn appellareueiimnq appellareueiinmq appellareueiinqm appellareueiqimn appellareueiqinm appellareueiqmin
appellareueiqmni appellareueiqnmi appellareueiqnim appellareueimqin appellareueimqni appellareueimiqn appellareueiminq
appellareueimniq appellareueimnqi appellareueinqmi appellareueinqim appellareueinmqi appellareueinmiq appellareueinimq
appellareueiniqm appellareeiniqum appellareeiniqmu appellareeiniuqm appellareeiniumq appellareeinimuq appellareeinimqu
appellareeinqium appellareeinqimu appellareeinquim appellareeinqumi appellareeinqmui appellareeinqmiu appellareeinuqim
appellareeinuqmi appellareeinuiqm appellareeinuimq appellareeinumiq appellareeinumqi appellareeinmqui appellareeinmqiu
appellareeinmuqi appellareeinmuiq appellareeinmiuq appellareeinmiqu appellareeiinqum appellareeiinqmu appellareeiinuqm
appellareeiinumq appellareeiinmuq appellareeiinmqu appellareeiiqnum appellareeiiqnmu appellareeiiqunm appellareeiiqumn
appellareeiiqmun appellareeiiqmnu appellareeiiuqnm appellareeiiuqmn appellareeiiunqm appellareeiiunmq appellareeiiumnq
appellareeiiumqn appellareeiimqun appellareeiimqnu appellareeiimuqn appellareeiimunq appellareeiimnuq appellareeiimnqu
appellareeiqinum appellareeiqinmu appellareeiqiunm appellareeiqiumn appellareeiqimun appellareeiqimnu appellareeiqnium
appellareeiqnimu appellareeiqnuim appellareeiqnumi appellareeiqnmui appellareeiqnmiu appellareeiqunim appellareeiqunmi
appellareeiquinm appellareeiquimn appellareeiqumin appellareeiqumni appellareeiqmnui appellareeiqmniu appellareeiqmuni
appellareeiqmuin appellareeiqmiun appellareeiqminu appellareeiuiqnm appellareeiuiqmn appellareeiuinqm appellareeiuinmq
appellareeiuimnq appellareeiuimqn appellareeiuqinm appellareeiuqimn appellareeiuqnim appellareeiuqnmi appellareeiuqmni
appellareeiuqmin appellareeiunqim appellareeiunqmi appellareeiuniqm appellareeiunimq appellareeiunmiq appellareeiunmqi
appellareeiumqni appellareeiumqin appellareeiumnqi appellareeiumniq appellareeiuminq appellareeiumiqn appellareeimiqun
appellareeimiqnu appellareeimiuqn appellareeimiunq appellareeiminuq appellareeiminqu appellareeimqiun appellareeimqinu
appellareeimquin appellareeimquni appellareeimqnui appellareeimqniu appellareeimuqin appellareeimuqni appellareeimuiqn
appellareeimuinq appellareeimuniq appellareeimunqi appellareeimnqui appellareeimnqiu appellareeimnuqi appellareeimnuiq
appellareeimniuq appellareeimniqu appellareeniiqum appellareeniiqmu appellareeniiuqm appellareeniiumq appellareeniimuq
appellareeniimqu appellareeniqium appellareeniqimu appellareeniquim appellareeniqumi appellareeniqmui appellareeniqmiu
appellareeniuqim appellareeniuqmi appellareeniuiqm appellareeniuimq appellareeniumiq appellareeniumqi appellareenimqui
appellareenimqiu appellareenimuqi appellareenimuiq appellareenimiuq appellareenimiqu appellareeniiqum appellareeniiqmu
appellareeniiuqm appellareeniiumq appellareeniimuq appellareeniimqu appellareeniqium appellareeniqimu appellareeniquim
appellareeniqumi appellareeniqmui appellareeniqmiu appellareeniuqim appellareeniuqmi appellareeniuiqm appellareeniuimq
appellareeniumiq appellareeniumqi appellareenimqui appellareenimqiu appellareenimuqi appellareenimuiq appellareenimiuq
appellareenimiqu appellareenqiium appellareenqiimu appellareenqiuim appellareenqiumi appellareenqimui appellareenqimiu
appellareenqiium appellareenqiimu appellareenqiuim appellareenqiumi appellareenqimui appellareenqimiu appellareenquiim
appellareenquimi appellareenquiim appellareenquimi appellareenqumii appellareenqumii appellareenqmiui appellareenqmiiu
appellareenqmuii appellareenqmuii appellareenqmiui appellareenqmiiu appellareenuiqim appellareenuiqmi appellareenuiiqm
appellareenuiimq appellareenuimiq appellareenuimqi appellareenuqiim appellareenuqimi appellareenuqiim appellareenuqimi
appellareenuqmii appellareenuqmii appellareenuiqim appellareenuiqmi appellareenuiiqm appellareenuiimq appellareenuimiq
appellareenuimqi appellareenumqii appellareenumqii appellareenumiqi appellareenumiiq appellareenumiiq appellareenumiqi
appellareenmiqui appellareenmiqiu appellareenmiuqi appellareenmiuiq appellareenmiiuq appellareenmiiqu appellareenmqiui
appellareenmqiiu appellareenmquii appellareenmquii appellareenmqiui appellareenmqiiu appellareenmuqii appellareenmuqii
appellareenmuiqi appellareenmuiiq appellareenmuiiq appellareenmuiqi appellareenmiqui appellareenmiqiu appellareenmiuqi
appellareenmiuiq appellareenmiiuq appellareenmiiqu appellareeiniqum appellareeiniqmu appellareeiniuqm appellareeiniumq
appellareeinimuq appellareeinimqu appellareeinqium appellareeinqimu appellareeinquim appellareeinqumi appellareeinqmui
appellareeinqmiu appellareeinuqim appellareeinuqmi appellareeinuiqm appellareeinuimq appellareeinumiq appellareeinumqi
appellareeinmqui appellareeinmqiu appellareeinmuqi appellareeinmuiq appellareeinmiuq appellareeinmiqu appellareeiinqum
appellareeiinqmu appellareeiinuqm appellareeiinumq appellareeiinmuq appellareeiinmqu appellareeiiqnum appellareeiiqnmu
appellareeiiqunm appellareeiiqumn appellareeiiqmun appellareeiiqmnu appellareeiiuqnm appellareeiiuqmn appellareeiiunqm
appellareeiiunmq appellareeiiumnq appellareeiiumqn appellareeiimqun appellareeiimqnu appellareeiimuqn appellareeiimunq
appellareeiimnuq appellareeiimnqu appellareeiqinum appellareeiqinmu appellareeiqiunm appellareeiqiumn appellareeiqimun
appellareeiqimnu appellareeiqnium appellareeiqnimu appellareeiqnuim appellareeiqnumi appellareeiqnmui appellareeiqnmiu
appellareeiqunim appellareeiqunmi appellareeiquinm appellareeiquimn appellareeiqumin appellareeiqumni appellareeiqmnui
appellareeiqmniu appellareeiqmuni appellareeiqmuin appellareeiqmiun appellareeiqminu appellareeiuiqnm appellareeiuiqmn
appellareeiuinqm appellareeiuinmq appellareeiuimnq appellareeiuimqn appellareeiuqinm appellareeiuqimn appellareeiuqnim
appellareeiuqnmi appellareeiuqmni appellareeiuqmin appellareeiunqim appellareeiunqmi appellareeiuniqm appellareeiunimq
appellareeiunmiq appellareeiunmqi appellareeiumqni appellareeiumqin appellareeiumnqi appellareeiumniq appellareeiuminq
appellareeiumiqn appellareeimiqun appellareeimiqnu appellareeimiuqn appellareeimiunq appellareeiminuq appellareeiminqu
appellareeimqiun appellareeimqinu appellareeimquin appellareeimquni appellareeimqnui appellareeimqniu appellareeimuqin
appellareeimuqni appellareeimuiqn appellareeimuinq appellareeimuniq appellareeimunqi appellareeimnqui appellareeimnqiu
appellareeimnuqi appellareeimnuiq appellareeimniuq appellareeimniqu appellareeqniium appellareeqniimu appellareeqniuim
appellareeqniumi appellareeqnimui appellareeqnimiu appellareeqniium appellareeqniimu appellareeqniuim appellareeqniumi
appellareeqnimui appellareeqnimiu appellareeqnuiim appellareeqnuimi appellareeqnuiim appellareeqnuimi appellareeqnumii
appellareeqnumii appellareeqnmiui appellareeqnmiiu appellareeqnmuii appellareeqnmuii appellareeqnmiui appellareeqnmiiu
appellareeqinium appellareeqinimu appellareeqinuim appellareeqinumi appellareeqinmui appellareeqinmiu appellareeqiinum
appellareeqiinmu appellareeqiiunm appellareeqiiumn appellareeqiimun appellareeqiimnu appellareeqiuinm appellareeqiuimn
appellareeqiunim appellareeqiunmi appellareeqiumni appellareeqiumin appellareeqimiun appellareeqiminu appellareeqimuin
appellareeqimuni appellareeqimnui appellareeqimniu appellareeqiinum appellareeqiinmu appellareeqiiunm appellareeqiiumn
appellareeqiimun appellareeqiimnu appellareeqinium appellareeqinimu appellareeqinuim appellareeqinumi appellareeqinmui
appellareeqinmiu appellareeqiunim appellareeqiunmi appellareeqiuinm appellareeqiuimn appellareeqiumin appellareeqiumni
appellareeqimnui appellareeqimniu appellareeqimuni appellareeqimuin appellareeqimiun appellareeqiminu appellareequiinm
appellareequiimn appellareequinim appellareequinmi appellareequimni appellareequimin appellareequiinm appellareequiimn
appellareequinim appellareequinmi appellareequimni appellareequimin appellareequniim appellareequnimi appellareequniim
appellareequnimi appellareequnmii appellareequnmii appellareequmini appellareequmiin appellareequmnii appellareequmnii
appellareequmini appellareequmiin appellareeqmiiun appellareeqmiinu appellareeqmiuin appellareeqmiuni appellareeqminui
appellareeqminiu appellareeqmiiun appellareeqmiinu appellareeqmiuin appellareeqmiuni appellareeqminui appellareeqminiu
appellareeqmuiin appellareeqmuini appellareeqmuiin appellareeqmuini appellareeqmunii appellareeqmunii appellareeqmniui
appellareeqmniiu appellareeqmnuii appellareeqmnuii appellareeqmniui appellareeqmniiu appellareeuniqim appellareeuniqmi
appellareeuniiqm appellareeuniimq appellareeunimiq appellareeunimqi appellareeunqiim appellareeunqimi appellareeunqiim
appellareeunqimi appellareeunqmii appellareeunqmii appellareeuniqim appellareeuniqmi appellareeuniiqm appellareeuniimq
appellareeunimiq appellareeunimqi appellareeunmqii appellareeunmqii appellareeunmiqi appellareeunmiiq appellareeunmiiq
appellareeunmiqi appellareeuinqim appellareeuinqmi appellareeuiniqm appellareeuinimq appellareeuinmiq appellareeuinmqi
appellareeuiqnim appellareeuiqnmi appellareeuiqinm appellareeuiqimn appellareeuiqmin appellareeuiqmni appellareeuiiqnm
appellareeuiiqmn appellareeuiinqm appellareeuiinmq appellareeuiimnq appellareeuiimqn appellareeuimqin appellareeuimqni
appellareeuimiqn appellareeuiminq appellareeuimniq appellareeuimnqi appellareeuqinim appellareeuqinmi appellareeuqiinm
appellareeuqiimn appellareeuqimin appellareeuqimni appellareeuqniim appellareeuqnimi appellareeuqniim appellareeuqnimi
appellareeuqnmii appellareeuqnmii appellareeuqinim appellareeuqinmi appellareeuqiinm appellareeuqiimn appellareeuqimin
appellareeuqimni appellareeuqmnii appellareeuqmnii appellareeuqmini appellareeuqmiin appellareeuqmiin appellareeuqmini
appellareeuiiqnm appellareeuiiqmn appellareeuiinqm appellareeuiinmq appellareeuiimnq appellareeuiimqn appellareeuiqinm
appellareeuiqimn appellareeuiqnim appellareeuiqnmi appellareeuiqmni appellareeuiqmin appellareeuinqim appellareeuinqmi
appellareeuiniqm appellareeuinimq appellareeuinmiq appellareeuinmqi appellareeuimqni appellareeuimqin appellareeuimnqi
appellareeuimniq appellareeuiminq appellareeuimiqn appellareeumiqin appellareeumiqni appellareeumiiqn appellareeumiinq
appellareeuminiq appellareeuminqi appellareeumqiin appellareeumqini appellareeumqiin appellareeumqini appellareeumqnii
appellareeumqnii appellareeumiqin appellareeumiqni appellareeumiiqn appellareeumiinq appellareeuminiq appellareeuminqi
appellareeumnqii appellareeumnqii appellareeumniqi appellareeumniiq appellareeumniiq appellareeumniqi appellareemniqui
appellareemniqiu appellareemniuqi appellareemniuiq appellareemniiuq appellareemniiqu appellareemnqiui appellareemnqiiu
appellareemnquii appellareemnquii appellareemnqiui appellareemnqiiu appellareemnuqii appellareemnuqii appellareemnuiqi
appellareemnuiiq appellareemnuiiq appellareemnuiqi appellareemniqui appellareemniqiu appellareemniuqi appellareemniuiq
appellareemniiuq appellareemniiqu appellareeminqui appellareeminqiu appellareeminuqi appellareeminuiq appellareeminiuq
appellareeminiqu appellareemiqnui appellareemiqniu appellareemiquni appellareemiquin appellareemiqiun appellareemiqinu
appellareemiuqni appellareemiuqin appellareemiunqi appellareemiuniq appellareemiuinq appellareemiuiqn appellareemiiqun
appellareemiiqnu appellareemiiuqn appellareemiiunq appellareemiinuq appellareemiinqu appellareemqinui appellareemqiniu
appellareemqiuni appellareemqiuin appellareemqiiun appellareemqiinu appellareemqniui appellareemqniiu appellareemqnuii
appellareemqnuii appellareemqniui appellareemqniiu appellareemqunii appellareemqunii appellareemquini appellareemquiin
appellareemquiin appellareemquini appellareemqinui appellareemqiniu appellareemqiuni appellareemqiuin appellareemqiiun
appellareemqiinu appellareemuiqni appellareemuiqin appellareemuinqi appellareemuiniq appellareemuiinq appellareemuiiqn
appellareemuqini appellareemuqiin appellareemuqnii appellareemuqnii appellareemuqini appellareemuqiin appellareemunqii
appellareemunqii appellareemuniqi appellareemuniiq appellareemuniiq appellareemuniqi appellareemuiqni appellareemuiqin
appellareemuinqi appellareemuiniq appellareemuiinq appellareemuiiqn appellareemiiqun appellareemiiqnu appellareemiiuqn
appellareemiiunq appellareemiinuq appellareemiinqu appellareemiqiun appellareemiqinu appellareemiquin appellareemiquni
appellareemiqnui appellareemiqniu appellareemiuqin appellareemiuqni appellareemiuiqn appellareemiuinq appellareemiuniq
appellareemiunqi appellareeminqui appellareeminqiu appellareeminuqi appellareeminuiq appellareeminiuq appellareeminiqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us