easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ensmall

cultrosque

bachmann

blackwellii

indignantesque

eccoprotic

pettiness

zairo

flectobacillus

depressives

italianizer

dispending

nigglingly

palmipes

swinney

timueramque

haemodoraceae

nullisome


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: apparere
cipher variations:
bqqbsfsf crrctgtg dssduhuh ettevivi fuufwjwj
gvvgxkxk hwwhylyl ixxizmzm jyyjanan kzzkbobo
laalcpcp mbbmdqdq nccnerer oddofsfs peepgtgt
qffqhuhu rggriviv shhsjwjw tiitkxkx ujjulyly
vkkvmzmz wllwnana xmmxobob ynnypcpc zoozqdqd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: apparere
Cipher: zkkziviv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: apparere
Cipher: AAAAA ABBBA ABBBA AAAAA BAAAA AABAA BAAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: apparere
cipher variations:
bqqbsfsfbuubananbyybivivbccbqdqdbggbylylbkkbgtgtbssbwjwjbwwberer
baabmzmzbeebuhuhbiibcpcpbmmbkxkxcrrctgtgcvvcboboczzcjwjwcddcrere
chhczmzmcllchuhucttcxkxkcxxcfsfscbbcnanacffcvivicjjcdqdqcnnclyly
dssduhuhdwwdcpcpdaadkxkxdeedsfsfdiidanandmmdivivduudylyldyydgtgt
dccdobobdggdwjwjdkkdererdoodmzmzetteviviexxedqdqebbelylyeffetgtg
ejjeboboennejwjwevvezmzmezzehuhueddepcpcehhexkxkellefsfseppenana
fuufwjwjfyyfererfccfmzmzfggfuhuhfkkfcpcpfoofkxkxfwwfananfaafiviv
feefqdqdfiifylylfmmfgtgtfqqfobobgvvgxkxkgzzgfsfsgddgnanaghhgvivi
gllgdqdqgppglylygxxgbobogbbgjwjwgffgreregjjgzmzmgnnghuhugrrgpcpc
hwwhylylhaahgtgtheehobobhiihwjwjhmmhererhqqhmzmzhyyhcpcphcchkxkx
hgghsfsfhkkhananhoohivivhsshqdqdixxizmzmibbihuhuiffipcpcijjixkxk
innifsfsirrinanaizzidqdqiddilylyihhitgtgilliboboippijwjwittirere
jyyjananjccjivivjggjqdqdjkkjylyljoojgtgtjssjobobjaajererjeejmzmz
jiijuhuhjmmjcpcpjqqjkxkxjuujsfsfkzzkbobokddkjwjwkhhkrerekllkzmzm
kppkhuhukttkpcpckbbkfsfskffknanakjjkviviknnkdqdqkrrklylykvvktgtg
laalcpcpleelkxkxliilsfsflmmlananlqqlivivluulqdqdlcclgtgtlgglobob
lkklwjwjloolererlsslmzmzlwwluhuhmbbmdqdqmffmlylymjjmtgtgmnnmbobo
mrrmjwjwmvvmreremddmhuhumhhmpcpcmllmxkxkmppmfsfsmttmnanamxxmvivi
nccnerernggnmzmznkknuhuhnooncpcpnssnkxkxnwwnsfsfneenivivniinqdqd
nmmnylylnqqngtgtnuunobobnyynwjwjoddofsfsohhonanaollovivioppodqdq
ottolylyoxxotgtgoffojwjwojjorereonnozmzmorrohuhuovvopcpcozzoxkxk
peepgtgtpiipobobpmmpwjwjpqqpererpuupmzmzpyypuhuhpggpkxkxpkkpsfsf
poopananpsspivivpwwpqdqdpaapylylqffqhuhuqjjqpcpcqnnqxkxkqrrqfsfs
qvvqnanaqzzqviviqhhqlylyqllqtgtgqppqboboqttqjwjwqxxqrereqbbqzmzm
rggrivivrkkrqdqdroorylylrssrgtgtrwwrobobraarwjwjriirmzmzrmmruhuh
rqqrcpcpruurkxkxryyrsfsfrccrananshhsjwjwsllsreresppszmzmsttshuhu
sxxspcpcsbbsxkxksjjsnanasnnsvivisrrsdqdqsvvslylyszzstgtgsddsbobo
tiitkxkxtmmtsfsftqqtanantuutivivtyytqdqdtcctylyltkktobobtootwjwj
tssterertwwtmzmztaatuhuhteetcpcpujjulylyunnutgtgurrubobouvvujwjw
uzzurereudduzmzmullupcpcuppuxkxkuttufsfsuxxunanaubbuviviuffudqdq
vkkvmzmzvoovuhuhvssvcpcpvwwvkxkxvaavsfsfveevananvmmvqdqdvqqvylyl
vuuvgtgtvyyvobobvccvwjwjvggvererwllwnanawppwviviwttwdqdqwxxwlyly
wbbwtgtgwffwbobownnwrerewrrwzmzmwvvwhuhuwzzwpcpcwddwxkxkwhhwfsfs
xmmxobobxqqxwjwjxuuxererxyyxmzmzxccxuhuhxggxcpcpxooxsfsfxssxanan
xwwxivivxaaxqdqdxeexylylxiixgtgtynnypcpcyrryxkxkyvvyfsfsyzzynana
yddyviviyhhydqdqyppytgtgyttyboboyxxyjwjwybbyrereyffyzmzmyjjyhuhu
zoozqdqdzsszylylzwwzgtgtzaazobobzeezwjwjziizererzqqzuhuhzuuzcpcp
zyyzkxkxzcczsfsfzggzananzkkzivivapparereattazmzmaxxahuhuabbapcpc
affaxkxkajjafsfsarraviviavvadqdqazzalylyaddatgtgahhaboboallajwjw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: apparere
Cipher: nccnerer

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: apparere
Cipher: 1153531124512451

Extended Methods:
Method #1

Plaintext: apparere
method variations:
fuufwkwklzzlbpbpqeeqguguvkkvmzmz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a p p a r e r e 
1 5 5 1 2 5 2 5 
1 3 3 1 4 1 4 1 
They are then read out in rows:
1551252513314141
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: apparere
Cipher: vewwlcdd

Read more ...
Method #3

Plaintext: apparere
method variations:
vxcfyfya xcfyfyav cfyfyavx
fyfyavxc yfyavxcf fyavxcfy
yavxcfyf avxcfyfy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: apparere

first 5040 cipher variations(40320 total)
apparere appareer apparree apparree apparere appareer appaerre appaerer appaerre appaerer appaeerr
appaeerr apparere appareer apparree apparree apparere appareer appaeerr appaeerr appaerer appaerre
appaerre appaerer appraere appraeer appraree appraree appraere appraeer appreare appreaer apprerae
apprerea appreera appreear apprreae apprreea apprraee apprraee apprreae apprreea appreera appreear
apprerea apprerae appreare appreaer apperare apperaer apperrae apperrea apperera apperear appearre
appearer appearre appearer appeaerr appeaerr apperare apperaer apperrae apperrea apperera apperear
appeearr appeearr appeerar appeerra appeerra appeerar apprreae apprreea apprraee apprraee apprreae
apprreea apprerae apprerea appreare appreaer appreear appreera appraere appraeer appraree appraree
appraere appraeer appreear appreera appreaer appreare apprerae apprerea apperera apperear apperrea
apperrae apperare apperaer appeerra appeerar appeerra appeerar appeearr appeearr apperera apperear
apperrea apperrae apperare apperaer appeaerr appeaerr appearer appearre appearre appearer apaprere
apapreer apaprree apaprree apaprere apapreer apaperre apaperer apaperre apaperer apapeerr apapeerr
apaprere apapreer apaprree apaprree apaprere apapreer apapeerr apapeerr apaperer apaperre apaperre
apaperer aparpere aparpeer aparpree aparpree aparpere aparpeer aparepre apareper aparerpe aparerep
apareerp apareepr aparrepe aparreep aparrpee aparrpee aparrepe aparreep apareerp apareepr aparerep
aparerpe aparepre apareper apaerpre apaerper apaerrpe apaerrep apaererp apaerepr apaeprre apaeprer
apaeprre apaeprer apaeperr apaeperr apaerpre apaerper apaerrpe apaerrep apaererp apaerepr apaeeprr
apaeeprr apaeerpr apaeerrp apaeerrp apaeerpr aparrepe aparreep aparrpee aparrpee aparrepe aparreep
aparerpe aparerep aparepre apareper apareepr apareerp aparpere aparpeer aparpree aparpree aparpere
aparpeer apareepr apareerp apareper aparepre aparerpe aparerep apaererp apaerepr apaerrep apaerrpe
apaerpre apaerper apaeerrp apaeerpr apaeerrp apaeerpr apaeeprr apaeeprr apaererp apaerepr apaerrep
apaerrpe apaerpre apaerper apaeperr apaeperr apaeprer apaeprre apaeprre apaeprer aprapere aprapeer
aprapree aprapree aprapere aprapeer apraepre apraeper apraerpe apraerep apraeerp apraeepr aprarepe
aprareep aprarpee aprarpee aprarepe aprareep apraeerp apraeepr apraerep apraerpe apraepre apraeper
aprpaere aprpaeer aprparee aprparee aprpaere aprpaeer aprpeare aprpeaer aprperae aprperea aprpeera
aprpeear aprpreae aprpreea aprpraee aprpraee aprpreae aprpreea aprpeera aprpeear aprperea aprperae
aprpeare aprpeaer aprepare aprepaer apreprae apreprea aprepera aprepear apreapre apreaper aprearpe
aprearep apreaerp apreaepr aprerape apreraep aprerpae aprerpea aprerepa aprereap apreearp apreeapr
apreerap apreerpa apreepra apreepar aprrpeae aprrpeea aprrpaee aprrpaee aprrpeae aprrpeea aprrepae
aprrepea aprreape aprreaep aprreeap aprreepa aprraepe aprraeep aprrapee aprrapee aprraepe aprraeep
aprreeap aprreepa aprreaep aprreape aprrepae aprrepea aprepera aprepear apreprea apreprae aprepare
aprepaer apreepra apreepar apreerpa apreerap apreearp apreeapr aprerepa aprereap aprerpea aprerpae
aprerape apreraep apreaerp apreaepr aprearep aprearpe apreapre apreaper apearpre apearper apearrpe
apearrep apearerp apearepr apeaprre apeaprer apeaprre apeaprer apeaperr apeaperr apearpre apearper
apearrpe apearrep apearerp apearepr apeaeprr apeaeprr apeaerpr apeaerrp apeaerrp apeaerpr aperapre
aperaper aperarpe aperarep aperaerp aperaepr aperpare aperpaer aperprae aperprea aperpera aperpear
aperrpae aperrpea aperrape aperraep aperreap aperrepa aperepra aperepar apererpa apererap aperearp
apereapr apeprare apepraer apeprrae apeprrea apeprera apeprear apeparre apeparer apeparre apeparer
apepaerr apepaerr apeprare apepraer apeprrae apeprrea apeprera apeprear apepearr apepearr apeperar
apeperra apeperra apeperar aperrpae aperrpea aperrape aperraep aperreap aperrepa aperprae aperprea
aperpare aperpaer aperpear aperpera aperapre aperaper aperarpe aperarep aperaerp aperaepr aperepar
aperepra apereapr aperearp apererap apererpa apeerpra apeerpar apeerrpa apeerrap apeerarp apeerapr
apeeprra apeeprar apeeprra apeeprar apeeparr apeeparr apeerpra apeerpar apeerrpa apeerrap apeerarp
apeerapr apeeaprr apeeaprr apeearpr apeearrp apeearrp apeearpr aprarepe aprareep aprarpee aprarpee
aprarepe aprareep apraerpe apraerep apraepre apraeper apraeepr apraeerp aprapere aprapeer aprapree
aprapree aprapere aprapeer apraeepr apraeerp apraeper apraepre apraerpe apraerep aprraepe aprraeep
aprrapee aprrapee aprraepe aprraeep aprreape aprreaep aprrepae aprrepea aprreepa aprreeap aprrpeae
aprrpeea aprrpaee aprrpaee aprrpeae aprrpeea aprreepa aprreeap aprrepea aprrepae aprreape aprreaep
aprerape apreraep aprerpae aprerpea aprerepa aprereap aprearpe aprearep apreapre apreaper apreaepr
apreaerp aprepare aprepaer apreprae apreprea aprepera aprepear apreeapr apreearp apreepar apreepra
apreerpa apreerap aprpreae aprpreea aprpraee aprpraee aprpreae aprpreea aprperae aprperea aprpeare
aprpeaer aprpeear aprpeera aprpaere aprpaeer aprparee aprparee aprpaere aprpaeer aprpeear aprpeera
aprpeaer aprpeare aprperae aprperea aprerepa aprereap aprerpea aprerpae aprerape apreraep apreerpa
apreerap apreepra apreepar apreeapr apreearp aprepera aprepear apreprea apreprae aprepare aprepaer
apreaepr apreaerp apreaper apreapre aprearpe aprearep apearerp apearepr apearrep apearrpe apearpre
apearper apeaerrp apeaerpr apeaerrp apeaerpr apeaeprr apeaeprr apearerp apearepr apearrep apearrpe
apearpre apearper apeaperr apeaperr apeaprer apeaprre apeaprre apeaprer aperaerp aperaepr aperarep
aperarpe aperapre aperaper aperearp apereapr apererap apererpa aperepra aperepar aperreap aperrepa
aperraep aperrape aperrpae aperrpea aperpera aperpear aperprea aperprae aperpare aperpaer apeerarp
apeerapr apeerrap apeerrpa apeerpra apeerpar apeearrp apeearpr apeearrp apeearpr apeeaprr apeeaprr
apeerarp apeerapr apeerrap apeerrpa apeerpra apeerpar apeeparr apeeparr apeeprar apeeprra apeeprra
apeeprar aperreap aperrepa aperraep aperrape aperrpae aperrpea apererap apererpa aperearp apereapr
aperepar aperepra aperaerp aperaepr aperarep aperarpe aperapre aperaper aperpear aperpera aperpaer
aperpare aperprae aperprea apeprera apeprear apeprrea apeprrae apeprare apepraer apeperra apeperar
apeperra apeperar apepearr apepearr apeprera apeprear apeprrea apeprrae apeprare apepraer apepaerr
apepaerr apeparer apeparre apeparre apeparer apparere appareer apparree apparree apparere appareer
appaerre appaerer appaerre appaerer appaeerr appaeerr apparere appareer apparree apparree apparere
appareer appaeerr appaeerr appaerer appaerre appaerre appaerer appraere appraeer appraree appraree
appraere appraeer appreare appreaer apprerae apprerea appreera appreear apprreae apprreea apprraee
apprraee apprreae apprreea appreera appreear apprerea apprerae appreare appreaer apperare apperaer
apperrae apperrea apperera apperear appearre appearer appearre appearer appeaerr appeaerr apperare
apperaer apperrae apperrea apperera apperear appeearr appeearr appeerar appeerra appeerra appeerar
apprreae apprreea apprraee apprraee apprreae apprreea apprerae apprerea appreare appreaer appreear
appreera appraere appraeer appraree appraree appraere appraeer appreear appreera appreaer appreare
apprerae apprerea apperera apperear apperrea apperrae apperare apperaer appeerra appeerar appeerra
appeerar appeearr appeearr apperera apperear apperrea apperrae apperare apperaer appeaerr appeaerr
appearer appearre appearre appearer apaprere apapreer apaprree apaprree apaprere apapreer apaperre
apaperer apaperre apaperer apapeerr apapeerr apaprere apapreer apaprree apaprree apaprere apapreer
apapeerr apapeerr apaperer apaperre apaperre apaperer aparpere aparpeer aparpree aparpree aparpere
aparpeer aparepre apareper aparerpe aparerep apareerp apareepr aparrepe aparreep aparrpee aparrpee
aparrepe aparreep apareerp apareepr aparerep aparerpe aparepre apareper apaerpre apaerper apaerrpe
apaerrep apaererp apaerepr apaeprre apaeprer apaeprre apaeprer apaeperr apaeperr apaerpre apaerper
apaerrpe apaerrep apaererp apaerepr apaeeprr apaeeprr apaeerpr apaeerrp apaeerrp apaeerpr aparrepe
aparreep aparrpee aparrpee aparrepe aparreep aparerpe aparerep aparepre apareper apareepr apareerp
aparpere aparpeer aparpree aparpree aparpere aparpeer apareepr apareerp apareper aparepre aparerpe
aparerep apaererp apaerepr apaerrep apaerrpe apaerpre apaerper apaeerrp apaeerpr apaeerrp apaeerpr
apaeeprr apaeeprr apaererp apaerepr apaerrep apaerrpe apaerpre apaerper apaeperr apaeperr apaeprer
apaeprre apaeprre apaeprer aprapere aprapeer aprapree aprapree aprapere aprapeer apraepre apraeper
apraerpe apraerep apraeerp apraeepr aprarepe aprareep aprarpee aprarpee aprarepe aprareep apraeerp
apraeepr apraerep apraerpe apraepre apraeper aprpaere aprpaeer aprparee aprparee aprpaere aprpaeer
aprpeare aprpeaer aprperae aprperea aprpeera aprpeear aprpreae aprpreea aprpraee aprpraee aprpreae
aprpreea aprpeera aprpeear aprperea aprperae aprpeare aprpeaer aprepare aprepaer apreprae apreprea
aprepera aprepear apreapre apreaper aprearpe aprearep apreaerp apreaepr aprerape apreraep aprerpae
aprerpea aprerepa aprereap apreearp apreeapr apreerap apreerpa apreepra apreepar aprrpeae aprrpeea
aprrpaee aprrpaee aprrpeae aprrpeea aprrepae aprrepea aprreape aprreaep aprreeap aprreepa aprraepe
aprraeep aprrapee aprrapee aprraepe aprraeep aprreeap aprreepa aprreaep aprreape aprrepae aprrepea
aprepera aprepear apreprea apreprae aprepare aprepaer apreepra apreepar apreerpa apreerap apreearp
apreeapr aprerepa aprereap aprerpea aprerpae aprerape apreraep apreaerp apreaepr aprearep aprearpe
apreapre apreaper apearpre apearper apearrpe apearrep apearerp apearepr apeaprre apeaprer apeaprre
apeaprer apeaperr apeaperr apearpre apearper apearrpe apearrep apearerp apearepr apeaeprr apeaeprr
apeaerpr apeaerrp apeaerrp apeaerpr aperapre aperaper aperarpe aperarep aperaerp aperaepr aperpare
aperpaer aperprae aperprea aperpera aperpear aperrpae aperrpea aperrape aperraep aperreap aperrepa
aperepra aperepar apererpa apererap aperearp apereapr apeprare apepraer apeprrae apeprrea apeprera
apeprear apeparre apeparer apeparre apeparer apepaerr apepaerr apeprare apepraer apeprrae apeprrea
apeprera apeprear apepearr apepearr apeperar apeperra apeperra apeperar aperrpae aperrpea aperrape
aperraep aperreap aperrepa aperprae aperprea aperpare aperpaer aperpear aperpera aperapre aperaper
aperarpe aperarep aperaerp aperaepr aperepar aperepra apereapr aperearp apererap apererpa apeerpra
apeerpar apeerrpa apeerrap apeerarp apeerapr apeeprra apeeprar apeeprra apeeprar apeeparr apeeparr
apeerpra apeerpar apeerrpa apeerrap apeerarp apeerapr apeeaprr apeeaprr apeearpr apeearrp apeearrp
apeearpr aprarepe aprareep aprarpee aprarpee aprarepe aprareep apraerpe apraerep apraepre apraeper
apraeepr apraeerp aprapere aprapeer aprapree aprapree aprapere aprapeer apraeepr apraeerp apraeper
apraepre apraerpe apraerep aprraepe aprraeep aprrapee aprrapee aprraepe aprraeep aprreape aprreaep
aprrepae aprrepea aprreepa aprreeap aprrpeae aprrpeea aprrpaee aprrpaee aprrpeae aprrpeea aprreepa
aprreeap aprrepea aprrepae aprreape aprreaep aprerape apreraep aprerpae aprerpea aprerepa aprereap
aprearpe aprearep apreapre apreaper apreaepr apreaerp aprepare aprepaer apreprae apreprea aprepera
aprepear apreeapr apreearp apreepar apreepra apreerpa apreerap aprpreae aprpreea aprpraee aprpraee
aprpreae aprpreea aprperae aprperea aprpeare aprpeaer aprpeear aprpeera aprpaere aprpaeer aprparee
aprparee aprpaere aprpaeer aprpeear aprpeera aprpeaer aprpeare aprperae aprperea aprerepa aprereap
aprerpea aprerpae aprerape apreraep apreerpa apreerap apreepra apreepar apreeapr apreearp aprepera
aprepear apreprea apreprae aprepare aprepaer apreaepr apreaerp apreaper apreapre aprearpe aprearep
apearerp apearepr apearrep apearrpe apearpre apearper apeaerrp apeaerpr apeaerrp apeaerpr apeaeprr
apeaeprr apearerp apearepr apearrep apearrpe apearpre apearper apeaperr apeaperr apeaprer apeaprre
apeaprre apeaprer aperaerp aperaepr aperarep aperarpe aperapre aperaper aperearp apereapr apererap
apererpa aperepra aperepar aperreap aperrepa aperraep aperrape aperrpae aperrpea aperpera aperpear
aperprea aperprae aperpare aperpaer apeerarp apeerapr apeerrap apeerrpa apeerpra apeerpar apeearrp
apeearpr apeearrp apeearpr apeeaprr apeeaprr apeerarp apeerapr apeerrap apeerrpa apeerpra apeerpar
apeeparr apeeparr apeeprar apeeprra apeeprra apeeprar aperreap aperrepa aperraep aperrape aperrpae
aperrpea apererap apererpa aperearp apereapr aperepar aperepra aperaerp aperaepr aperarep aperarpe
aperapre aperaper aperpear aperpera aperpaer aperpare aperprae aperprea apeprera apeprear apeprrea
apeprrae apeprare apepraer apeperra apeperar apeperra apeperar apepearr apepearr apeprera apeprear
apeprrea apeprrae apeprare apepraer apepaerr apepaerr apeparer apeparre apeparre apeparer aapprere
aappreer aapprree aapprree aapprere aappreer aapperre aapperer aapperre aapperer aappeerr aappeerr
aapprere aappreer aapprree aapprree aapprere aappreer aappeerr aappeerr aapperer aapperre aapperre
aapperer aaprpere aaprpeer aaprpree aaprpree aaprpere aaprpeer aaprepre aapreper aaprerpe aaprerep
aapreerp aapreepr aaprrepe aaprreep aaprrpee aaprrpee aaprrepe aaprreep aapreerp aapreepr aaprerep
aaprerpe aaprepre aapreper aaperpre aaperper aaperrpe aaperrep aapererp aaperepr aapeprre aapeprer
aapeprre aapeprer aapeperr aapeperr aaperpre aaperper aaperrpe aaperrep aapererp aaperepr aapeeprr
aapeeprr aapeerpr aapeerrp aapeerrp aapeerpr aaprrepe aaprreep aaprrpee aaprrpee aaprrepe aaprreep
aaprerpe aaprerep aaprepre aapreper aapreepr aapreerp aaprpere aaprpeer aaprpree aaprpree aaprpere
aaprpeer aapreepr aapreerp aapreper aaprepre aaprerpe aaprerep aapererp aaperepr aaperrep aaperrpe
aaperpre aaperper aapeerrp aapeerpr aapeerrp aapeerpr aapeeprr aapeeprr aapererp aaperepr aaperrep
aaperrpe aaperpre aaperper aapeperr aapeperr aapeprer aapeprre aapeprre aapeprer aapprere aappreer
aapprree aapprree aapprere aappreer aapperre aapperer aapperre aapperer aappeerr aappeerr aapprere
aappreer aapprree aapprree aapprere aappreer aappeerr aappeerr aapperer aapperre aapperre aapperer
aaprpere aaprpeer aaprpree aaprpree aaprpere aaprpeer aaprepre aapreper aaprerpe aaprerep aapreerp
aapreepr aaprrepe aaprreep aaprrpee aaprrpee aaprrepe aaprreep aapreerp aapreepr aaprerep aaprerpe
aaprepre aapreper aaperpre aaperper aaperrpe aaperrep aapererp aaperepr aapeprre aapeprer aapeprre
aapeprer aapeperr aapeperr aaperpre aaperper aaperrpe aaperrep aapererp aaperepr aapeeprr aapeeprr
aapeerpr aapeerrp aapeerrp aapeerpr aaprrepe aaprreep aaprrpee aaprrpee aaprrepe aaprreep aaprerpe
aaprerep aaprepre aapreper aapreepr aapreerp aaprpere aaprpeer aaprpree aaprpree aaprpere aaprpeer
aapreepr aapreerp aapreper aaprepre aaprerpe aaprerep aapererp aaperepr aaperrep aaperrpe aaperpre
aaperper aapeerrp aapeerpr aapeerrp aapeerpr aapeeprr aapeeprr aapererp aaperepr aaperrep aaperrpe
aaperpre aaperper aapeperr aapeperr aapeprer aapeprre aapeprre aapeprer aarppere aarppeer aarppree
aarppree aarppere aarppeer aarpepre aarpeper aarperpe aarperep aarpeerp aarpeepr aarprepe aarpreep
aarprpee aarprpee aarprepe aarpreep aarpeerp aarpeepr aarperep aarperpe aarpepre aarpeper aarppere
aarppeer aarppree aarppree aarppere aarppeer aarpepre aarpeper aarperpe aarperep aarpeerp aarpeepr
aarprepe aarpreep aarprpee aarprpee aarprepe aarpreep aarpeerp aarpeepr aarperep aarperpe aarpepre
aarpeper aareppre aarepper aareprpe aareprep aareperp aarepepr aareppre aarepper aareprpe aareprep
aareperp aarepepr aarerppe aarerpep aarerppe aarerpep aarerepp aarerepp aareeprp aareeppr aareerpp
aareerpp aareeprp aareeppr aarrpepe aarrpeep aarrppee aarrppee aarrpepe aarrpeep aarreppe aarrepep
aarreppe aarrepep aarreepp aarreepp aarrpepe aarrpeep aarrppee aarrppee aarrpepe aarrpeep aarreepp
aarreepp aarrepep aarreppe aarreppe aarrepep aareperp aarepepr aareprep aareprpe aareppre aarepper
aareeprp aareeppr aareerpp aareerpp aareeprp aareeppr aarerepp aarerepp aarerpep aarerppe aarerppe
aarerpep aareperp aarepepr aareprep aareprpe aareppre aarepper aaeprpre aaeprper aaeprrpe aaeprrep
aaeprerp aaeprepr aaepprre aaepprer aaepprre aaepprer aaepperr aaepperr aaeprpre aaeprper aaeprrpe
aaeprrep aaeprerp aaeprepr aaepeprr aaepeprr aaeperpr aaeperrp aaeperrp aaeperpr aaerppre aaerpper
aaerprpe aaerprep aaerperp aaerpepr aaerppre aaerpper aaerprpe aaerprep aaerperp aaerpepr aaerrppe
aaerrpep aaerrppe aaerrpep aaerrepp aaerrepp aaereprp aaereppr aaererpp aaererpp aaereprp aaereppr
aaeprpre aaeprper aaeprrpe aaeprrep aaeprerp aaeprepr aaepprre aaepprer aaepprre aaepprer aaepperr
aaepperr aaeprpre aaeprper aaeprrpe aaeprrep aaeprerp aaeprepr aaepeprr aaepeprr aaeperpr aaeperrp
aaeperrp aaeperpr aaerrppe aaerrpep aaerrppe aaerrpep aaerrepp aaerrepp aaerprpe aaerprep aaerppre
aaerpper aaerpepr aaerperp aaerppre aaerpper aaerprpe aaerprep aaerperp aaerpepr aaereppr aaereprp
aaereppr aaereprp aaererpp aaererpp aaeerprp aaeerppr aaeerrpp aaeerrpp aaeerprp aaeerppr aaeeprrp
aaeeprpr aaeeprrp aaeeprpr aaeepprr aaeepprr aaeerprp aaeerppr aaeerrpp aaeerrpp aaeerprp aaeerppr
aaeepprr aaeepprr aaeeprpr aaeeprrp aaeeprrp aaeeprpr aarprepe aarpreep aarprpee aarprpee aarprepe
aarpreep aarperpe aarperep aarpepre aarpeper aarpeepr aarpeerp aarppere aarppeer aarppree aarppree
aarppere aarppeer aarpeepr aarpeerp aarpeper aarpepre aarperpe aarperep aarrpepe aarrpeep aarrppee
aarrppee aarrpepe aarrpeep aarreppe aarrepep aarreppe aarrepep aarreepp aarreepp aarrpepe aarrpeep
aarrppee aarrppee aarrpepe aarrpeep aarreepp aarreepp aarrepep aarreppe aarreppe aarrepep aarerppe
aarerpep aarerppe aarerpep aarerepp aarerepp aareprpe aareprep aareppre aarepper aarepepr aareperp
aareppre aarepper aareprpe aareprep aareperp aarepepr aareeppr aareeprp aareeppr aareeprp aareerpp
aareerpp aarprepe aarpreep aarprpee aarprpee aarprepe aarpreep aarperpe aarperep aarpepre aarpeper
aarpeepr aarpeerp aarppere aarppeer aarppree aarppree aarppere aarppeer aarpeepr aarpeerp aarpeper
aarpepre aarperpe aarperep aarerepp aarerepp aarerpep aarerppe aarerppe aarerpep aareerpp aareerpp
aareeprp aareeppr aareeppr aareeprp aareperp aarepepr aareprep aareprpe aareppre aarepper aarepepr
aareperp aarepper aareppre aareprpe aareprep aaeprerp aaeprepr aaeprrep aaeprrpe aaeprpre aaeprper
aaeperrp aaeperpr aaeperrp aaeperpr aaepeprr aaepeprr aaeprerp aaeprepr aaeprrep aaeprrpe aaeprpre
aaeprper aaepperr aaepperr aaepprer aaepprre aaepprre aaepprer aaerperp aaerpepr aaerprep aaerprpe
aaerppre aaerpper aaereprp aaereppr aaererpp aaererpp aaereprp aaereppr aaerrepp aaerrepp aaerrpep
aaerrppe aaerrppe aaerrpep aaerperp aaerpepr aaerprep aaerprpe aaerppre aaerpper aaeerprp aaeerppr
aaeerrpp aaeerrpp aaeerprp aaeerppr aaeeprrp aaeeprpr aaeeprrp aaeeprpr aaeepprr aaeepprr aaeerprp
aaeerppr aaeerrpp aaeerrpp aaeerprp aaeerppr aaeepprr aaeepprr aaeeprpr aaeeprrp aaeeprrp aaeeprpr
aaerrepp aaerrepp aaerrpep aaerrppe aaerrppe aaerrpep aaererpp aaererpp aaereprp aaereppr aaereppr
aaereprp aaerperp aaerpepr aaerprep aaerprpe aaerppre aaerpper aaerpepr aaerperp aaerpper aaerppre
aaerprpe aaerprep aaeprerp aaeprepr aaeprrep aaeprrpe aaeprpre aaeprper aaeperrp aaeperpr aaeperrp
aaeperpr aaepeprr aaepeprr aaeprerp aaeprepr aaeprrep aaeprrpe aaeprpre aaeprper aaepperr aaepperr
aaepprer aaepprre aaepprre aaepprer arpapere arpapeer arpapree arpapree arpapere arpapeer arpaepre
arpaeper arpaerpe arpaerep arpaeerp arpaeepr arparepe arpareep arparpee arparpee arparepe arpareep
arpaeerp arpaeepr arpaerep arpaerpe arpaepre arpaeper arppaere arppaeer arpparee arpparee arppaere
arppaeer arppeare arppeaer arpperae arpperea arppeera arppeear arppreae arppreea arppraee arppraee
arppreae arppreea arppeera arppeear arpperea arpperae arppeare arppeaer arpepare arpepaer arpeprae
arpeprea arpepera arpepear arpeapre arpeaper arpearpe arpearep arpeaerp arpeaepr arperape arperaep
arperpae arperpea arperepa arpereap arpeearp arpeeapr arpeerap arpeerpa arpeepra arpeepar arprpeae
arprpeea arprpaee arprpaee arprpeae arprpeea arprepae arprepea arpreape arpreaep arpreeap arpreepa
arpraepe arpraeep arprapee arprapee arpraepe arpraeep arpreeap arpreepa arpreaep arpreape arprepae
arprepea arpepera arpepear arpeprea arpeprae arpepare arpepaer arpeepra arpeepar arpeerpa arpeerap
arpeearp arpeeapr arperepa arpereap arperpea arperpae arperape arperaep arpeaerp arpeaepr arpearep
arpearpe arpeapre arpeaper arappere arappeer arappree arappree arappere arappeer arapepre arapeper
araperpe araperep arapeerp arapeepr araprepe arapreep araprpee araprpee araprepe arapreep arapeerp
arapeepr araperep araperpe arapepre arapeper arappere arappeer arappree arappree arappere arappeer
arapepre arapeper araperpe araperep arapeerp arapeepr araprepe arapreep araprpee araprpee araprepe
arapreep arapeerp arapeepr araperep araperpe arapepre arapeper araeppre araepper araeprpe araeprep
araeperp araepepr araeppre araepper araeprpe araeprep araeperp araepepr araerppe araerpep araerppe
araerpep araerepp araerepp araeeprp araeeppr araeerpp araeerpp araeeprp araeeppr ararpepe ararpeep
ararppee ararppee ararpepe ararpeep arareppe ararepep arareppe ararepep arareepp arareepp ararpepe
ararpeep ararppee ararppee ararpepe ararpeep arareepp arareepp ararepep arareppe arareppe ararepep
araeperp araepepr araeprep araeprpe araeppre araepper araeeprp araeeppr araeerpp araeerpp araeeprp
araeeppr araerepp araerepp araerpep araerppe araerppe araerpep araeperp araepepr araeprep araeprpe
araeppre araepper arpapere arpapeer arpapree arpapree arpapere arpapeer arpaepre arpaeper arpaerpe
arpaerep arpaeerp arpaeepr arparepe arpareep arparpee arparpee arparepe arpareep arpaeerp arpaeepr
arpaerep arpaerpe arpaepre arpaeper arppaere arppaeer arpparee arpparee arppaere arppaeer arppeare
arppeaer arpperae arpperea arppeera arppeear arppreae arppreea arppraee arppraee arppreae arppreea
arppeera arppeear arpperea arpperae arppeare arppeaer arpepare arpepaer arpeprae arpeprea arpepera
arpepear arpeapre arpeaper arpearpe arpearep arpeaerp arpeaepr arperape arperaep arperpae arperpea
arperepa arpereap arpeearp arpeeapr arpeerap arpeerpa arpeepra arpeepar arprpeae arprpeea arprpaee
arprpaee arprpeae arprpeea arprepae arprepea arpreape arpreaep arpreeap arpreepa arpraepe arpraeep
arprapee arprapee arpraepe arpraeep arpreeap arpreepa arpreaep arpreape arprepae arprepea arpepera
arpepear arpeprea arpeprae arpepare arpepaer arpeepra arpeepar arpeerpa arpeerap arpeearp arpeeapr
arperepa arpereap arperpea arperpae arperape arperaep arpeaerp arpeaepr arpearep arpearpe arpeapre
arpeaper areappre areapper areaprpe areaprep areaperp areapepr areappre areapper areaprpe areaprep
areaperp areapepr arearppe arearpep arearppe arearpep arearepp arearepp areaeprp areaeppr areaerpp
areaerpp areaeprp areaeppr arepapre arepaper areparpe areparep arepaerp arepaepr areppare areppaer
arepprae arepprea areppera areppear areprpae areprpea areprape arepraep arepreap areprepa arepepra
arepepar areperpa areperap arepearp arepeapr areppare areppaer arepprae arepprea areppera areppear
arepapre arepaper areparpe areparep arepaerp arepaepr areprape arepraep areprpae areprpea areprepa
arepreap arepearp arepeapr areperap areperpa arepepra arepepar arerppae arerppea arerpape arerpaep
arerpeap arerpepa arerppae arerppea arerpape arerpaep arerpeap arerpepa arerappe arerapep arerappe
arerapep areraepp areraepp arerepap arereppa arereapp arereapp arerepap arereppa areeppra areeppar
areeprpa areeprap areeparp areepapr areeppra areeppar areeprpa areeprap areeparp areepapr areerppa
areerpap areerppa areerpap areerapp areerapp areeaprp areeappr areearpp areearpp areeaprp areeappr
arrapepe arrapeep arrappee arrappee arrapepe arrapeep arraeppe arraepep arraeppe arraepep arraeepp
arraeepp arrapepe arrapeep arrappee arrappee arrapepe arrapeep arraeepp arraeepp arraepep arraeppe
arraeppe arraepep arrpaepe arrpaeep arrpapee arrpapee arrpaepe arrpaeep arrpeape arrpeaep arrpepae
arrpepea arrpeepa arrpeeap arrppeae arrppeea arrppaee arrppaee arrppeae arrppeea arrpeepa arrpeeap
arrpepea arrpepae arrpeape arrpeaep arrepape arrepaep arreppae arreppea arrepepa arrepeap arreappe
arreapep arreappe arreapep arreaepp arreaepp arrepape arrepaep arreppae arreppea arrepepa arrepeap
arreeapp arreeapp arreepap arreeppa arreeppa arreepap arrppeae arrppeea arrppaee arrppaee arrppeae
arrppeea arrpepae arrpepea arrpeape arrpeaep arrpeeap arrpeepa arrpaepe arrpaeep arrpapee arrpapee
arrpaepe arrpaeep arrpeeap arrpeepa arrpeaep arrpeape arrpepae arrpepea arrepepa arrepeap arreppea
arreppae arrepape arrepaep arreeppa arreepap arreeppa arreepap arreeapp arreeapp arrepepa arrepeap
arreppea arreppae arrepape arrepaep arreaepp arreaepp arreapep arreappe arreappe arreapep areaperp
areapepr areaprep areaprpe areappre areapper areaeprp areaeppr areaerpp areaerpp areaeprp areaeppr
arearepp arearepp arearpep arearppe arearppe arearpep areaperp areapepr areaprep areaprpe areappre
areapper arepaerp arepaepr areparep areparpe arepapre arepaper arepearp arepeapr areperap areperpa
arepepra arepepar arepreap areprepa arepraep areprape areprpae areprpea areppera areppear arepprea
arepprae areppare areppaer areeparp areepapr areeprap areeprpa areeppra areeppar areeaprp areeappr
areearpp areearpp areeaprp areeappr areerapp areerapp areerpap areerppa areerppa areerpap areeparp
areepapr areeprap areeprpa areeppra areeppar arerpeap arerpepa arerpaep arerpape arerppae arerppea
arerepap arereppa arereapp arereapp arerepap arereppa areraepp areraepp arerapep arerappe arerappe
arerapep arerpeap arerpepa arerpaep arerpape arerppae arerppea areppera areppear arepprea arepprae
areppare areppaer arepepra arepepar areperpa areperap arepearp arepeapr areprepa arepreap areprpea
areprpae areprape arepraep arepaerp arepaepr areparep areparpe arepapre arepaper aeparpre aeparper
aeparrpe aeparrep aeparerp aeparepr aepaprre aepaprer aepaprre aepaprer aepaperr aepaperr aeparpre
aeparper aeparrpe aeparrep aeparerp aeparepr aepaeprr aepaeprr aepaerpr aepaerrp aepaerrp aepaerpr
aeprapre aepraper aeprarpe aeprarep aepraerp aepraepr aeprpare aeprpaer aeprprae aeprprea aeprpera
aeprpear aeprrpae aeprrpea aeprrape aeprraep aeprreap aeprrepa aeprepra aeprepar aeprerpa aeprerap
aeprearp aepreapr aepprare aeppraer aepprrae aepprrea aepprera aepprear aepparre aepparer aepparre
aepparer aeppaerr aeppaerr aepprare aeppraer aepprrae aepprrea aepprera aepprear aeppearr aeppearr
aepperar aepperra aepperra aepperar aeprrpae aeprrpea aeprrape aeprraep aeprreap aeprrepa aeprprae
aeprprea aeprpare aeprpaer aeprpear aeprpera aeprapre aepraper aeprarpe aeprarep aepraerp aepraepr
aeprepar aeprepra aepreapr aeprearp aeprerap aeprerpa aeperpra aeperpar aeperrpa aeperrap aeperarp
aeperapr aepeprra aepeprar aepeprra aepeprar aepeparr aepeparr aeperpra aeperpar aeperrpa aeperrap
aeperarp aeperapr aepeaprr aepeaprr aepearpr aepearrp aepearrp aepearpr aeaprpre aeaprper aeaprrpe
aeaprrep aeaprerp aeaprepr aeapprre aeapprer aeapprre aeapprer aeapperr aeapperr aeaprpre aeaprper
aeaprrpe aeaprrep aeaprerp aeaprepr aeapeprr aeapeprr aeaperpr aeaperrp aeaperrp aeaperpr aearppre
aearpper aearprpe aearprep aearperp aearpepr aearppre aearpper aearprpe aearprep aearperp aearpepr
aearrppe aearrpep aearrppe aearrpep aearrepp aearrepp aeareprp aeareppr aearerpp aearerpp aeareprp
aeareppr aeaprpre aeaprper aeaprrpe aeaprrep aeaprerp aeaprepr aeapprre aeapprer aeapprre aeapprer
aeapperr aeapperr aeaprpre aeaprper aeaprrpe aeaprrep aeaprerp aeaprepr aeapeprr aeapeprr aeaperpr
aeaperrp aeaperrp aeaperpr aearrppe aearrpep aearrppe aearrpep aearrepp aearrepp aearprpe aearprep
aearppre aearpper aearpepr aearperp aearppre aearpper aearprpe aearprep aearperp aearpepr aeareppr
aeareprp aeareppr aeareprp aearerpp aearerpp aeaerprp aeaerppr aeaerrpp aeaerrpp aeaerprp aeaerppr
aeaeprrp aeaeprpr aeaeprrp aeaeprpr aeaepprr aeaepprr aeaerprp aeaerppr aeaerrpp aeaerrpp aeaerprp
aeaerppr aeaepprr aeaepprr aeaeprpr aeaeprrp aeaeprrp aeaeprpr aerappre aerapper aeraprpe aeraprep
aeraperp aerapepr aerappre aerapper aeraprpe aeraprep aeraperp aerapepr aerarppe aerarpep aerarppe
aerarpep aerarepp aerarepp aeraeprp aeraeppr aeraerpp aeraerpp aeraeprp aeraeppr aerpapre aerpaper
aerparpe aerparep aerpaerp aerpaepr aerppare aerppaer aerpprae aerpprea aerppera aerppear aerprpae
aerprpea aerprape aerpraep aerpreap aerprepa aerpepra aerpepar aerperpa aerperap aerpearp aerpeapr
aerppare aerppaer aerpprae aerpprea aerppera aerppear aerpapre aerpaper aerparpe aerparep aerpaerp
aerpaepr aerprape aerpraep aerprpae aerprpea aerprepa aerpreap aerpearp aerpeapr aerperap aerperpa
aerpepra aerpepar aerrppae aerrppea aerrpape aerrpaep aerrpeap aerrpepa aerrppae aerrppea aerrpape
aerrpaep aerrpeap aerrpepa aerrappe aerrapep aerrappe aerrapep aerraepp aerraepp aerrepap aerreppa
aerreapp aerreapp aerrepap aerreppa aereppra aereppar aereprpa aereprap aereparp aerepapr aereppra
aereppar aereprpa aereprap aereparp aerepapr aererppa aererpap aererppa aererpap aererapp aererapp
aereaprp aereappr aerearpp aerearpp aereaprp aereappr aeparpre aeparper aeparrpe aeparrep aeparerp
aeparepr aepaprre aepaprer aepaprre aepaprer aepaperr aepaperr aeparpre aeparper aeparrpe aeparrep
aeparerp aeparepr aepaeprr aepaeprr aepaerpr aepaerrp aepaerrp aepaerpr aeprapre aepraper aeprarpe
aeprarep aepraerp aepraepr aeprpare aeprpaer aeprprae aeprprea aeprpera aeprpear aeprrpae aeprrpea
aeprrape aeprraep aeprreap aeprrepa aeprepra aeprepar aeprerpa aeprerap aeprearp aepreapr aepprare
aeppraer aepprrae aepprrea aepprera aepprear aepparre aepparer aepparre aepparer aeppaerr aeppaerr
aepprare aeppraer aepprrae aepprrea aepprera aepprear aeppearr aeppearr aepperar aepperra aepperra
aepperar aeprrpae aeprrpea aeprrape aeprraep aeprreap aeprrepa aeprprae aeprprea aeprpare aeprpaer
aeprpear aeprpera aeprapre aepraper aeprarpe aeprarep aepraerp aepraepr aeprepar aeprepra aepreapr
aeprearp aeprerap aeprerpa aeperpra aeperpar aeperrpa aeperrap aeperarp aeperapr aepeprra aepeprar
aepeprra aepeprar aepeparr aepeparr aeperpra aeperpar aeperrpa aeperrap aeperarp aeperapr aepeaprr
aepeaprr aepearpr aepearrp aepearrp aepearpr aerarppe aerarpep aerarppe aerarpep aerarepp aerarepp
aeraprpe aeraprep aerappre aerapper aerapepr aeraperp aerappre aerapper aeraprpe aeraprep aeraperp
aerapepr aeraeppr aeraeprp aeraeppr aeraeprp aeraerpp aeraerpp aerrappe aerrapep aerrappe aerrapep
aerraepp aerraepp aerrpape aerrpaep aerrppae aerrppea aerrpepa aerrpeap aerrppae aerrppea aerrpape
aerrpaep aerrpeap aerrpepa aerreppa aerrepap aerreppa aerrepap aerreapp aerreapp aerprape aerpraep
aerprpae aerprpea aerprepa aerpreap aerparpe aerparep aerpapre aerpaper aerpaepr aerpaerp aerppare
aerppaer aerpprae aerpprea aerppera aerppear aerpeapr aerpearp aerpepar aerpepra aerperpa aerperap
aerprpae aerprpea aerprape aerpraep aerpreap aerprepa aerpprae aerpprea aerppare aerppaer aerppear
aerppera aerpapre aerpaper aerparpe aerparep aerpaerp aerpaepr aerpepar aerpepra aerpeapr aerpearp
aerperap aerperpa aererppa aererpap aererppa aererpap aererapp aererapp aereprpa aereprap aereppra
aereppar aerepapr aereparp aereppra aereppar aereprpa aereprap aereparp aerepapr aereappr aereaprp
aereappr aereaprp aerearpp aerearpp aeearprp aeearppr aeearrpp aeearrpp aeearprp aeearppr aeeaprrp
aeeaprpr aeeaprrp aeeaprpr aeeapprr aeeapprr aeearprp aeearppr aeearrpp aeearrpp aeearprp aeearppr
aeeapprr aeeapprr aeeaprpr aeeaprrp aeeaprrp aeeaprpr aeeraprp aeerappr aeerarpp aeerarpp aeeraprp
aeerappr aeerparp aeerpapr aeerprap aeerprpa aeerppra aeerppar aeerrpap aeerrppa aeerrapp aeerrapp
aeerrpap aeerrppa aeerppra aeerppar aeerprpa aeerprap aeerparp aeerpapr aeeprarp aeeprapr aeeprrap
aeeprrpa aeeprpra aeeprpar aeeparrp aeeparpr aeeparrp aeeparpr aeepaprr aeepaprr aeeprarp aeeprapr
aeeprrap aeeprrpa aeeprpra aeeprpar aeepparr aeepparr aeepprar aeepprra aeepprra aeepprar aeerrpap
aeerrppa aeerrapp aeerrapp aeerrpap aeerrppa aeerprap aeerprpa aeerparp aeerpapr aeerppar aeerppra
aeeraprp aeerappr aeerarpp aeerarpp aeeraprp aeerappr aeerppar aeerppra aeerpapr aeerparp aeerprap
aeerprpa aeeprpra aeeprpar aeeprrpa aeeprrap aeeprarp aeeprapr aeepprra aeepprar aeepprra aeepprar
aeepparr aeepparr aeeprpra aeeprpar aeeprrpa aeeprrap aeeprarp aeeprapr aeepaprr aeepaprr aeeparpr
aeeparrp aeeparrp aeeparpr arparepe arpareep arparpee arparpee arparepe arpareep arpaerpe arpaerep
arpaepre arpaeper arpaeepr arpaeerp arpapere arpapeer arpapree arpapree arpapere arpapeer arpaeepr
arpaeerp arpaeper arpaepre arpaerpe arpaerep arpraepe arpraeep arprapee arprapee arpraepe arpraeep
arpreape arpreaep arprepae arprepea arpreepa arpreeap arprpeae arprpeea arprpaee arprpaee arprpeae
arprpeea arpreepa arpreeap arprepea arprepae arpreape arpreaep arperape arperaep arperpae arperpea
arperepa arpereap arpearpe arpearep arpeapre arpeaper arpeaepr arpeaerp arpepare arpepaer arpeprae
arpeprea arpepera arpepear arpeeapr arpeearp arpeepar arpeepra arpeerpa arpeerap arppreae arppreea
arppraee arppraee arppreae arppreea arpperae arpperea arppeare arppeaer arppeear arppeera arppaere
arppaeer arpparee arpparee arppaere arppaeer arppeear arppeera arppeaer arppeare arpperae arpperea
arperepa arpereap arperpea arperpae arperape arperaep arpeerpa arpeerap arpeepra arpeepar arpeeapr
arpeearp arpepera arpepear arpeprea arpeprae arpepare arpepaer arpeaepr arpeaerp arpeaper arpeapre
arpearpe arpearep araprepe arapreep araprpee araprpee araprepe arapreep araperpe araperep arapepre
arapeper arapeepr arapeerp arappere arappeer arappree arappree arappere arappeer arapeepr arapeerp
arapeper arapepre araperpe araperep ararpepe ararpeep ararppee ararppee ararpepe ararpeep arareppe
ararepep arareppe ararepep arareepp arareepp ararpepe ararpeep ararppee ararppee ararpepe ararpeep
arareepp arareepp ararepep arareppe arareppe ararepep araerppe araerpep araerppe araerpep araerepp
araerepp araeprpe araeprep araeppre araepper araepepr araeperp araeppre araepper araeprpe araeprep
araeperp araepepr araeeppr araeeprp araeeppr araeeprp araeerpp araeerpp araprepe arapreep araprpee
araprpee araprepe arapreep araperpe araperep arapepre arapeper arapeepr arapeerp arappere arappeer
arappree arappree arappere arappeer arapeepr arapeerp arapeper arapepre araperpe araperep araerepp
araerepp araerpep araerppe araerppe araerpep araeerpp araeerpp araeeprp araeeppr araeeppr araeeprp
araeperp araepepr araeprep araeprpe araeppre araepper araepepr araeperp araepper araeppre araeprpe
araeprep arrapepe arrapeep arrappee arrappee arrapepe arrapeep arraeppe arraepep arraeppe arraepep
arraeepp arraeepp arrapepe arrapeep arrappee arrappee arrapepe arrapeep arraeepp arraeepp arraepep
arraeppe arraeppe arraepep arrpaepe arrpaeep arrpapee arrpapee arrpaepe arrpaeep arrpeape arrpeaep
arrpepae arrpepea arrpeepa arrpeeap arrppeae arrppeea arrppaee arrppaee arrppeae arrppeea arrpeepa
arrpeeap arrpepea arrpepae arrpeape arrpeaep arrepape arrepaep arreppae arreppea arrepepa arrepeap
arreappe arreapep arreappe arreapep arreaepp arreaepp arrepape arrepaep arreppae arreppea arrepepa
arrepeap arreeapp arreeapp arreepap arreeppa arreeppa arreepap arrppeae arrppeea arrppaee arrppaee
arrppeae arrppeea arrpepae arrpepea arrpeape arrpeaep arrpeeap arrpeepa arrpaepe arrpaeep arrpapee
arrpapee arrpaepe arrpaeep arrpeeap arrpeepa arrpeaep arrpeape arrpepae arrpepea arrepepa arrepeap
arreppea arreppae arrepape arrepaep arreeppa arreepap arreeppa arreepap arreeapp arreeapp arrepepa
arrepeap arreppea arreppae arrepape arrepaep arreaepp arreaepp arreapep arreappe arreappe arreapep
arearppe arearpep arearppe arearpep arearepp arearepp areaprpe areaprep areappre areapper areapepr
areaperp areappre areapper areaprpe areaprep areaperp areapepr areaeppr areaeprp areaeppr areaeprp
areaerpp areaerpp arerappe arerapep arerappe arerapep areraepp areraepp arerpape arerpaep arerppae
arerppea arerpepa arerpeap arerppae arerppea arerpape arerpaep arerpeap arerpepa arereppa arerepap
arereppa arerepap arereapp arereapp areprape arepraep areprpae areprpea areprepa arepreap areparpe
areparep arepapre arepaper arepaepr arepaerp areppare areppaer arepprae arepprea areppera areppear
arepeapr arepearp arepepar arepepra areperpa areperap areprpae areprpea areprape arepraep arepreap
areprepa arepprae arepprea areppare areppaer areppear areppera arepapre arepaper areparpe areparep
arepaerp arepaepr arepepar arepepra arepeapr arepearp areperap areperpa areerppa areerpap areerppa
areerpap areerapp areerapp areeprpa areeprap areeppra areeppar areepapr areeparp areeppra areeppar
areeprpa areeprap areeparp areepapr areeappr areeaprp areeappr areeaprp areearpp areearpp arparepe
arpareep arparpee arparpee arparepe arpareep arpaerpe arpaerep arpaepre arpaeper arpaeepr arpaeerp
arpapere arpapeer arpapree arpapree arpapere arpapeer arpaeepr arpaeerp arpaeper arpaepre arpaerpe
arpaerep arpraepe arpraeep arprapee arprapee arpraepe arpraeep arpreape arpreaep arprepae arprepea
arpreepa arpreeap arprpeae arprpeea arprpaee arprpaee arprpeae arprpeea arpreepa arpreeap arprepea
arprepae arpreape arpreaep arperape arperaep arperpae arperpea arperepa arpereap arpearpe arpearep
arpeapre arpeaper arpeaepr arpeaerp arpepare arpepaer arpeprae arpeprea arpepera arpepear arpeeapr
arpeearp arpeepar arpeepra arpeerpa arpeerap arppreae arppreea arppraee arppraee arppreae arppreea
arpperae arpperea arppeare arppeaer arppeear arppeera arppaere arppaeer arpparee arpparee arppaere
arppaeer arppeear arppeera arppeaer arppeare arpperae arpperea arperepa arpereap arperpea arperpae
arperape arperaep arpeerpa arpeerap arpeepra arpeepar arpeeapr arpeearp arpepera arpepear arpeprea
arpeprae arpepare arpepaer arpeaepr arpeaerp arpeaper arpeapre arpearpe arpearep arearepp arearepp
arearpep arearppe arearppe arearpep areaerpp areaerpp areaeprp areaeppr areaeppr areaeprp areaperp
areapepr areaprep areaprpe areappre areapper areapepr areaperp areapper areappre areaprpe areaprep
areraepp areraepp arerapep arerappe arerappe arerapep arereapp arereapp arerepap arereppa arereppa
arerepap arerpeap arerpepa arerpaep arerpape arerppae arerppea arerpepa arerpeap arerppea arerppae
arerpape arerpaep areerapp areerapp areerpap areerppa areerppa areerpap areearpp areearpp areeaprp
areeappr areeappr areeaprp areeparp areepapr areeprap areeprpa areeppra areeppar areepapr areeparp
areeppar areeppra areeprpa areeprap arepreap areprepa arepraep areprape areprpae areprpea areperap
areperpa arepearp arepeapr arepepar arepepra arepaerp arepaepr areparep areparpe arepapre arepaper
areppear areppera areppaer areppare arepprae arepprea areprepa arepreap areprpea areprpae areprape
arepraep areperpa areperap arepepra arepepar arepeapr arepearp areppera areppear arepprea arepprae
areppare areppaer arepaepr arepaerp arepaper arepapre areparpe areparep aeparerp aeparepr aeparrep
aeparrpe aeparpre aeparper aepaerrp aepaerpr aepaerrp aepaerpr aepaeprr aepaeprr aeparerp aeparepr
aeparrep aeparrpe aeparpre aeparper aepaperr aepaperr aepaprer aepaprre aepaprre aepaprer aepraerp
aepraepr aeprarep aeprarpe aeprapre aepraper aeprearp aepreapr aeprerap aeprerpa aeprepra aeprepar
aeprreap aeprrepa aeprraep aeprrape aeprrpae aeprrpea aeprpera aeprpear aeprprea aeprprae aeprpare
aeprpaer aeperarp aeperapr aeperrap aeperrpa aeperpra aeperpar aepearrp aepearpr aepearrp aepearpr
aepeaprr aepeaprr aeperarp aeperapr aeperrap aeperrpa aeperpra aeperpar aepeparr aepeparr aepeprar
aepeprra aepeprra aepeprar aeprreap aeprrepa aeprraep aeprrape aeprrpae aeprrpea aeprerap aeprerpa
aeprearp aepreapr aeprepar aeprepra aepraerp aepraepr aeprarep aeprarpe aeprapre aepraper aeprpear
aeprpera aeprpaer aeprpare aeprprae aeprprea aepprera aepprear aepprrea aepprrae aepprare aeppraer
aepperra aepperar aepperra aepperar aeppearr aeppearr aepprera aepprear aepprrea aepprrae aepprare
aeppraer aeppaerr aeppaerr aepparer aepparre aepparre aepparer aeaprerp aeaprepr aeaprrep aeaprrpe
aeaprpre aeaprper aeaperrp aeaperpr aeaperrp aeaperpr aeapeprr aeapeprr aeaprerp aeaprepr aeaprrep
aeaprrpe aeaprpre aeaprper aeapperr aeapperr aeapprer aeapprre aeapprre aeapprer aearperp aearpepr
aearprep aearprpe aearppre aearpper aeareprp aeareppr aearerpp aearerpp aeareprp aeareppr aearrepp
aearrepp aearrpep aearrppe aearrppe aearrpep aearperp aearpepr aearprep aearprpe aearppre aearpper
aeaerprp aeaerppr aeaerrpp aeaerrpp aeaerprp aeaerppr aeaeprrp aeaeprpr aeaeprrp aeaeprpr aeaepprr
aeaepprr aeaerprp aeaerppr aeaerrpp aeaerrpp aeaerprp aeaerppr aeaepprr aeaepprr aeaeprpr aeaeprrp
aeaeprrp aeaeprpr aearrepp aearrepp aearrpep aearrppe aearrppe aearrpep aearerpp aearerpp aeareprp
aeareppr aeareppr aeareprp aearperp aearpepr aearprep aearprpe aearppre aearpper aearpepr aearperp
aearpper aearppre aearprpe aearprep aeaprerp aeaprepr aeaprrep aeaprrpe aeaprpre aeaprper aeaperrp
aeaperpr aeaperrp aeaperpr aeapeprr aeapeprr aeaprerp aeaprepr aeaprrep aeaprrpe aeaprpre aeaprper
aeapperr aeapperr aeapprer aeapprre aeapprre aeapprer aeraperp aerapepr aeraprep aeraprpe aerappre
aerapper aeraeprp aeraeppr aeraerpp aeraerpp aeraeprp aeraeppr aerarepp aerarepp aerarpep aerarppe
aerarppe aerarpep aeraperp aerapepr aeraprep aeraprpe aerappre aerapper aerpaerp aerpaepr aerparep
aerparpe aerpapre aerpaper aerpearp aerpeapr aerperap aerperpa aerpepra aerpepar aerpreap aerprepa
aerpraep aerprape aerprpae aerprpea aerppera aerppear aerpprea aerpprae aerppare aerppaer aereparp
aerepapr aereprap aereprpa aereppra aereppar aereaprp aereappr aerearpp aerearpp aereaprp aereappr
aererapp aererapp aererpap aererppa aererppa aererpap aereparp aerepapr aereprap aereprpa aereppra
aereppar aerrpeap aerrpepa aerrpaep aerrpape aerrppae aerrppea aerrepap aerreppa aerreapp aerreapp
aerrepap aerreppa aerraepp aerraepp aerrapep aerrappe aerrappe aerrapep aerrpeap aerrpepa aerrpaep
aerrpape aerrppae aerrppea aerppera aerppear aerpprea aerpprae aerppare aerppaer aerpepra aerpepar
aerperpa aerperap aerpearp aerpeapr aerprepa aerpreap aerprpea aerprpae aerprape aerpraep aerpaerp
aerpaepr aerparep aerparpe aerpapre aerpaper aeearprp aeearppr aeearrpp aeearrpp aeearprp aeearppr
aeeaprrp aeeaprpr aeeaprrp aeeaprpr aeeapprr aeeapprr aeearprp aeearppr aeearrpp aeearrpp aeearprp
aeearppr aeeapprr aeeapprr aeeaprpr aeeaprrp aeeaprrp aeeaprpr aeeraprp aeerappr aeerarpp aeerarpp
aeeraprp aeerappr aeerparp aeerpapr aeerprap aeerprpa aeerppra aeerppar aeerrpap aeerrppa aeerrapp
aeerrapp aeerrpap aeerrppa aeerppra aeerppar aeerprpa aeerprap aeerparp aeerpapr aeeprarp aeeprapr
aeeprrap aeeprrpa aeeprpra aeeprpar aeeparrp aeeparpr aeeparrp aeeparpr aeepaprr aeepaprr aeeprarp
aeeprapr aeeprrap aeeprrpa aeeprpra aeeprpar aeepparr aeepparr aeepprar aeepprra aeepprra aeepprar
aeerrpap aeerrppa aeerrapp aeerrapp aeerrpap aeerrppa aeerprap aeerprpa aeerparp aeerpapr aeerppar
aeerppra aeeraprp aeerappr aeerarpp aeerarpp aeeraprp aeerappr aeerppar aeerppra aeerpapr aeerparp
aeerprap aeerprpa aeeprpra aeeprpar aeeprrpa aeeprrap aeeprarp aeeprapr aeepprra aeepprar aeepprra
aeepprar aeepparr aeepparr aeeprpra aeeprpar aeeprrpa aeeprrap aeeprarp aeeprapr aeepaprr aeepaprr
aeeparpr aeeparrp aeeparrp aeeparpr aerarepp aerarepp aerarpep aerarppe aerarppe aerarpep aeraerpp
aeraerpp aeraeprp aeraeppr aeraeppr aeraeprp aeraperp aerapepr aeraprep aeraprpe aerappre aerapper
aerapepr aeraperp aerapper aerappre aeraprpe aeraprep aerraepp aerraepp aerrapep aerrappe aerrappe
aerrapep aerreapp aerreapp aerrepap aerreppa aerreppa aerrepap aerrpeap aerrpepa aerrpaep aerrpape
aerrppae aerrppea aerrpepa aerrpeap aerrppea aerrppae aerrpape aerrpaep aererapp aererapp aererpap
aererppa aererppa aererpap aerearpp aerearpp aereaprp aereappr aereappr aereaprp aereparp aerepapr
aereprap aereprpa aereppra aereppar aerepapr aereparp aereppar aereppra aereprpa aereprap aerpreap
aerprepa aerpraep aerprape aerprpae aerprpea aerperap aerperpa aerpearp aerpeapr aerpepar aerpepra
aerpaerp aerpaepr aerparep aerparpe aerpapre aerpaper aerppear aerppera aerppaer aerppare aerpprae
aerpprea aerprepa aerpreap aerprpea aerprpae aerprape aerpraep aerperpa aerperap aerpepra aerpepar
aerpeapr aerpearp aerppera aerppear aerpprea aerpprae aerppare aerppaer aerpaepr aerpaerp aerpaper
aerpapre aerparpe aerparep aeparerp aeparepr aeparrep aeparrpe aeparpre aeparper aepaerrp aepaerpr
aepaerrp aepaerpr aepaeprr aepaeprr aeparerp aeparepr aeparrep aeparrpe aeparpre aeparper aepaperr
aepaperr aepaprer aepaprre aepaprre aepaprer aepraerp aepraepr aeprarep aeprarpe aeprapre aepraper
aeprearp aepreapr aeprerap aeprerpa aeprepra aeprepar aeprreap aeprrepa aeprraep aeprrape aeprrpae
aeprrpea aeprpera aeprpear aeprprea aeprprae aeprpare aeprpaer aeperarp aeperapr aeperrap aeperrpa
aeperpra aeperpar aepearrp aepearpr aepearrp aepearpr aepeaprr aepeaprr aeperarp aeperapr aeperrap
aeperrpa aeperpra aeperpar aepeparr aepeparr aepeprar aepeprra aepeprra aepeprar aeprreap aeprrepa
aeprraep aeprrape aeprrpae aeprrpea aeprerap aeprerpa aeprearp aepreapr aeprepar aeprepra aepraerp
aepraepr aeprarep aeprarpe aeprapre aepraper aeprpear aeprpera aeprpaer aeprpare aeprprae aeprprea
aepprera aepprear aepprrea aepprrae aepprare aeppraer aepperra aepperar aepperra aepperar aeppearr
aeppearr aepprera aepprear aepprrea aepprrae aepprare aeppraer aeppaerr aeppaerr aepparer aepparre
aepparre aepparer

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us