easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

innova

brabantio

anacrisis

distinguo

irith

mccrorey

mallear

railhead

justis

didelphoid

minburn

electorally

promiebamusque

vagarique

lemniscatic

careening

tartarated

ululaverimus


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: amiata
cipher variations:
bnjbub cokcvc dpldwd eqmexe frnfyf
gsogzg htphah iuqibi jvrjcj kwskdk
lxtlel myumfm nzvngn oawoho pbxpip
qcyqjq rdzrkr seasls tfbtmt ugcunu
vhdvov wiewpw xjfxqx ykgyry zlhzsz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: amiata
Cipher: znrzgz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: amiata
Cipher: AAAAA ABABB ABAAA AAAAA BAABA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: amiata
cipher variations:
bnjbubblzbgbbjpbsbbhfbebbfvbqbbdlbcbbzrbabbxhbmb
bvxbybbtnbkbbrdbwbbptbibcokcvccmachcckqctccigcfc
cgwcrccemcdccascbccyicnccwyczccuoclccsecxccqucjc
dpldwddnbdiddlrduddjhdgddhxdsddfndeddbtdcddzjdod
dxzdaddvpdmddtfdyddrvdkdeqmexeeocejeemseveekiehe
eiyeteegoefeecuedeeakepeeyaebeewqeneeugezeeswele
frnfyffpdfkffntfwffljfiffjzfuffhpfgffdvfeffblfqf
fzbfcffxrfoffvhfafftxfmfgsogzggqeglggougxggmkgjg
gkagvggiqghggewgfggcmgrggacgdggysgpggwigbgguygng
htphahhrfhmhhpvhyhhnlhkhhlbhwhhjrhihhfxhghhdnhsh
hbdhehhzthqhhxjhchhvzhohiuqibiisginiiqwiziiomili
imcixiiksijiigyihiieoitiiceifiiauiriiykidiiwaipi
jvrjcjjthjojjrxjajjpnjmjjndjyjjltjkjjhzjijjfpjuj
jdfjgjjbvjsjjzljejjxbjqjkwskdkkuikpkksykbkkqoknk
koekzkkmuklkkiakjkkgqkvkkegkhkkcwktkkamkfkkyckrk
lxtlellvjlqlltzlcllrplollpflallnvlmlljblkllhrlwl
lfhlilldxlullbnlgllzdlslmyumfmmwkmrmmuamdmmsqmpm
mqgmbmmowmnmmkcmlmmismxmmgimjmmeymvmmcomhmmaemtm
nzvngnnxlnsnnvbnenntrnqnnrhncnnpxnonnldnmnnjtnyn
nhjnknnfznwnndpninnbfnunoawohooymotoowcofoousoro
osiodooqyopoomeonookuozooikoloogaoxooeqojoocgovo
pbxpippznpuppxdpgppvtpspptjpepprzpqppnfpopplvpap
pjlpmpphbpyppfrpkppdhpwpqcyqjqqaoqvqqyeqhqqwuqtq
qukqfqqsaqrqqogqpqqmwqbqqkmqnqqicqzqqgsqlqqeiqxq
rdzrkrrbprwrrzfrirrxvrurrvlrgrrtbrsrrphrqrrnxrcr
rlnrorrjdrarrhtrmrrfjryrseaslsscqsxssagsjssywsvs
swmshssucstssqisrssoysdssmospsskesbssiusnssgkszs
tfbtmttdrtyttbhtkttzxtwttxntittvdtuttrjtsttpztet
tnptqttlftcttjvtotthltatugcunuuesuzuuciuluuayuxu
uyoujuuweuvuuskutuuqaufuuoquruumguduukwupuuimubu
vhdvovvftvavvdjvmvvbzvyvvzpvkvvxfvwvvtlvuvvrbvgv
vprvsvvnhvevvlxvqvvjnvcvwiewpwwguwbwwekwnwwcawzw
waqwlwwygwxwwumwvwwscwhwwqswtwwoiwfwwmywrwwkowdw
xjfxqxxhvxcxxflxoxxdbxaxxbrxmxxzhxyxxvnxwxxtdxix
xrtxuxxpjxgxxnzxsxxlpxexykgyryyiwydyygmypyyecyby
ycsynyyaiyzyywoyxyyueyjyysuyvyyqkyhyyoaytyymqyfy
zlhzszzjxzezzhnzqzzfdzczzdtzozzbjzazzxpzyzzvfzkz
ztvzwzzrlzizzpbzuzznrzgzamiataakyafaaioaraageada
aeuapaackabaayqazaawgalaauwaxaasmajaaqcavaaosaha

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: amiata
Cipher: nzvngn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: amiata
Cipher: 112342114411

Extended Methods:
Method #1

Plaintext: amiata
method variations:
frofyflwtldlqbyqiqvgdvov

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a m i a t a 
1 2 4 1 4 1 
1 3 2 1 4 1 
They are then read out in rows:
124141132141
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: amiata
Cipher: fddlbd

Read more ...
Method #3

Plaintext: amiata
method variations:
fsbqda sbqdaf bqdafs
qdafsb dafsbq afsbqd

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: amiata

all 720 cipher variations:
amiata amiaat amitaa amitaa amiata amiaat amaita amaiat amatia amatai amaati
amaait amtaia amtaai amtiaa amtiaa amtaia amtaai amaati amaait amatai amatia
amaita amaiat aimata aimaat aimtaa aimtaa aimata aimaat aiamta aiamat aiatma
aiatam aiaatm aiaamt aitama aitaam aitmaa aitmaa aitama aitaam aiaatm aiaamt
aiatam aiatma aiamta aiamat aaimta aaimat aaitma aaitam aaiatm aaiamt aamita
aamiat aamtia aamtai aamati aamait aatmia aatmai aatima aatiam aataim aatami
aaamti aaamit aaatmi aaatim aaaitm aaaimt atiama atiaam atimaa atimaa atiama
atiaam ataima ataiam atamia atamai ataami ataaim atmaia atmaai atmiaa atmiaa
atmaia atmaai ataami ataaim atamai atamia ataima ataiam aaiatm aaiamt aaitam
aaitma aaimta aaimat aaaitm aaaimt aaatim aaatmi aaamti aaamit aataim aatami
aatiam aatima aatmia aatmai aamati aamait aamtai aamtia aamita aamiat maiata
maiaat maitaa maitaa maiata maiaat maaita maaiat maatia maatai maaati maaait
mataia mataai matiaa matiaa mataia mataai maaati maaait maatai maatia maaita
maaiat miaata miaaat miataa miataa miaata miaaat miaata miaaat miataa miataa
miaata miaaat mitaaa mitaaa mitaaa mitaaa mitaaa mitaaa miaata miaaat miataa
miataa miaata miaaat maiata maiaat maitaa maitaa maiata maiaat maaita maaiat
maatia maatai maaati maaait mataia mataai matiaa matiaa mataia mataai maaati
maaait maatai maatia maaita maaiat mtiaaa mtiaaa mtiaaa mtiaaa mtiaaa mtiaaa
mtaiaa mtaiaa mtaaia mtaaai mtaaai mtaaia mtaaia mtaaai mtaiaa mtaiaa mtaaia
mtaaai mtaaai mtaaia mtaaai mtaaia mtaiaa mtaiaa maiata maiaat maitaa maitaa
maiata maiaat maaita maaiat maatia maatai maaati maaait mataia mataai matiaa
matiaa mataia mataai maaati maaait maatai maatia maaita maaiat imaata imaaat
imataa imataa imaata imaaat imaata imaaat imataa imataa imaata imaaat imtaaa
imtaaa imtaaa imtaaa imtaaa imtaaa imaata imaaat imataa imataa imaata imaaat
iamata iamaat iamtaa iamtaa iamata iamaat iaamta iaamat iaatma iaatam iaaatm
iaaamt iatama iataam iatmaa iatmaa iatama iataam iaaatm iaaamt iaatam iaatma
iaamta iaamat iaamta iaamat iaatma iaatam iaaatm iaaamt iamata iamaat iamtaa
iamtaa iamata iamaat iatmaa iatmaa iatama iataam iataam iatama iaamta iaamat
iaatma iaatam iaaatm iaaamt itaama itaaam itamaa itamaa itaama itaaam itaama
itaaam itamaa itamaa itaama itaaam itmaaa itmaaa itmaaa itmaaa itmaaa itmaaa
itaama itaaam itamaa itamaa itaama itaaam iaaatm iaaamt iaatam iaatma iaamta
iaamat iaaatm iaaamt iaatam iaatma iaamta iaamat iataam iatama iataam iatama
iatmaa iatmaa iamata iamaat iamtaa iamtaa iamata iamaat amiata amiaat amitaa
amitaa amiata amiaat amaita amaiat amatia amatai amaati amaait amtaia amtaai
amtiaa amtiaa amtaia amtaai amaati amaait amatai amatia amaita amaiat aimata
aimaat aimtaa aimtaa aimata aimaat aiamta aiamat aiatma aiatam aiaatm aiaamt
aitama aitaam aitmaa aitmaa aitama aitaam aiaatm aiaamt aiatam aiatma aiamta
aiamat aaimta aaimat aaitma aaitam aaiatm aaiamt aamita aamiat aamtia aamtai
aamati aamait aatmia aatmai aatima aatiam aataim aatami aaamti aaamit aaatmi
aaatim aaaitm aaaimt atiama atiaam atimaa atimaa atiama atiaam ataima ataiam
atamia atamai ataami ataaim atmaia atmaai atmiaa atmiaa atmaia atmaai ataami
ataaim atamai atamia ataima ataiam aaiatm aaiamt aaitam aaitma aaimta aaimat
aaaitm aaaimt aaatim aaatmi aaamti aaamit aataim aatami aatiam aatima aatmia
aatmai aamati aamait aamtai aamtia aamita aamiat tmiaaa tmiaaa tmiaaa tmiaaa
tmiaaa tmiaaa tmaiaa tmaiaa tmaaia tmaaai tmaaai tmaaia tmaaia tmaaai tmaiaa
tmaiaa tmaaia tmaaai tmaaai tmaaia tmaaai tmaaia tmaiaa tmaiaa timaaa timaaa
timaaa timaaa timaaa timaaa tiamaa tiamaa tiaama tiaaam tiaaam tiaama tiaama
tiaaam tiamaa tiamaa tiaama tiaaam tiaaam tiaama tiaaam tiaama tiamaa tiamaa
taimaa taimaa taiama taiaam taiaam taiama tamiaa tamiaa tamaia tamaai tamaai
tamaia taamia taamai taaima taaiam taaaim taaami taamai taamia taaami taaaim
taaiam taaima taiama taiaam taimaa taimaa taiama taiaam taaima taaiam taamia
taamai taaami taaaim tamaia tamaai tamiaa tamiaa tamaia tamaai taaami taaaim
taamai taamia taaima taaiam taiaam taiama taiaam taiama taimaa taimaa taaiam
taaima taaaim taaami taamai taamia taaaim taaami taaiam taaima taamia taamai
tamaai tamaia tamaai tamaia tamiaa tamiaa amiata amiaat amitaa amitaa amiata
amiaat amaita amaiat amatia amatai amaati amaait amtaia amtaai amtiaa amtiaa
amtaia amtaai amaati amaait amatai amatia amaita amaiat aimata aimaat aimtaa
aimtaa aimata aimaat aiamta aiamat aiatma aiatam aiaatm aiaamt aitama aitaam
aitmaa aitmaa aitama aitaam aiaatm aiaamt aiatam aiatma aiamta aiamat aaimta
aaimat aaitma aaitam aaiatm aaiamt aamita aamiat aamtia aamtai aamati aamait
aatmia aatmai aatima aatiam aataim aatami aaamti aaamit aaatmi aaatim aaaitm
aaaimt atiama atiaam atimaa atimaa atiama atiaam ataima ataiam atamia atamai
ataami ataaim atmaia atmaai atmiaa atmiaa atmaia atmaai ataami ataaim atamai
atamia ataima ataiam aaiatm aaiamt aaitam aaitma aaimta aaimat aaaitm aaaimt
aaatim aaatmi aaamti aaamit aataim aatami aatiam aatima aatmia aatmai aamati
aamait aamtai aamtia aamita aamiat

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us