easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

nodule

naviculoid

compertoque

bacteriophages

resupplied

depromeruntque

exspectavereque

guttural

hippocratic

dodge

dennison

pettet

thirsters

longiorem

atechny

diffarreation

guaranties

superaque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: aggresses
cipher variations:
bhhsfttft ciitguugu djjuhvvhv ekkviwwiw fllwjxxjx
gmmxkyyky hnnylzzlz ioozmaama jppanbbnb kqqboccoc
lrrcpddpd mssdqeeqe ntterffrf ouufsggsg pvvgthhth
qwwhuiiui rxxivjjvj syyjwkkwk tzzkxllxl uaalymmym
vbbmznnzn wccnaooao xddobppbp yeepcqqcq zffqdrrdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: aggresses
Cipher: zttivhhvh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: aggresses
Cipher: AAAAA AABBA AABBA BAAAA AABAA BAAAB BAAAB AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: aggresses
cipher variations:
bhhsfttftbttanddndbffivnnvnbrrqdxxdxbddylhhlhbppgtrrtrbnnwjlljlbzzervvrv
bllmzffzfbxxuhpphpbjjcpzzpzbvvkxjjxjciitguugucuuboeeoecggjwoowocssreyyey
ceezmiimicqqhussuscooxkmmkmcaafswwswcmmnaggagcyyviqqiqckkdqaaqacwwlykkyk
djjuhvvhvdvvcpffpfdhhkxppxpdttsfzzfzdffanjjnjdrrivttvtdppylnnlndbbgtxxtx
dnnobhhbhdzzwjrrjrdllerbbrbdxxmzllzlekkviwwiwewwdqggqgeiilyqqyqeuutgaaga
eggbokkokessjwuuwueqqzmoomoecchuyyuyeoopciicieaaxkssksemmfsccsceyynammam
fllwjxxjxfxxerhhrhfjjmzrrzrfvvuhbbhbfhhcpllplfttkxvvxvfrranppnpfddivzzvz
fppqdjjdjfbbylttltfnngtddtdfzzobnnbngmmxkyykygyyfsiisigkknassasgwwviccic
giidqmmqmguulywwywgssboqqoqgeejwaawagqqrekkekgcczmuumugoohueeuegaapcooco
hnnylzzlzhzzgtjjtjhllobttbthxxwjddjdhjjernnrnhvvmzxxzxhttcprrprhffkxbbxb
hrrsfllflhddanvvnvhppivffvfhbbqdppdpioozmaamaiaahukkukimmpcuucuiyyxkeeke
ikkfsoosoiwwnayyayiuudqssqsigglyccycisstgmmgmieebowwowiqqjwggwgiccreqqeq
jppanbbnbjbbivllvljnnqdvvdvjzzylfflfjllgtpptpjxxobzzbzjvverttrtjhhmzddzd
jttuhnnhnjffcpxxpxjrrkxhhxhjddsfrrfrkqqboccockccjwmmwmkoorewwewkaazmggmg
kmmhuqquqkyypcaacakwwfsuusukiinaeeaekuuviooiokggdqyyqyksslyiiyikeetgssgs
lrrcpddpdlddkxnnxnlppsfxxfxlbbanhhnhlnnivrrvrlzzqdbbdblxxgtvvtvljjobffbf
lvvwjppjplhherzzrzlttmzjjzjlffuhtthtmssdqeeqemeelyooyomqqtgyygymccboiioi
moojwsswsmaareccecmyyhuwwuwmkkpcggcgmwwxkqqkqmiifsaasamuunakkakmggviuuiu
ntterffrfnffmzppzpnrruhzzhznddcpjjpjnppkxttxtnbbsfddfdnzzivxxvxnllqdhhdh
nxxylrrlrnjjgtbbtbnvvobllblnhhwjvvjvouufsggsgoggnaqqaqossviaaiaoeedqkkqk
oqqlyuuyuocctgeegeoaajwyywyommreiieioyyzmssmsokkhuccucowwpcmmcmoiixkwwkw
pvvgthhthphhobrrbrpttwjbbjbpfferllrlprrmzvvzvpdduhffhfpbbkxzzxzpnnsfjjfj
pzzanttntpllivddvdpxxqdnndnpjjylxxlxqwwhuiiuiqiipcsscsquuxkcckcqggfsmmsm
qssnawwawqeeviggigqcclyaayaqootgkkgkqaabouuouqmmjweeweqyyreooeoqkkzmyymy
rxxivjjvjrjjqdttdtrvvylddldrhhgtnntnrttobxxbxrffwjhhjhrddmzbbzbrppuhllhl
rbbcpvvpvrnnkxffxfrzzsfppfprllanzznzsyyjwkkwkskkreuueuswwzmeemesiihuoouo
suupcyycysggxkiikiseenaccacsqqvimmimsccdqwwqwsoolyggygsaatgqqgqsmmboaaoa
tzzkxllxltllsfvvfvtxxanffnftjjivppvptvvqdzzdzthhyljjljtffobddbdtrrwjnnjn
tdderxxrxtppmzhhzhtbbuhrrhrtnncpbbpbuaalymmymummtgwwgwuyyboggogukkjwqqwq
uwwreaaeauiizmkkmkuggpceeceussxkookoueefsyysyuqqnaiiaiuccvissisuoodqccqc
vbbmznnznvnnuhxxhxvzzcphhphvllkxrrxrvxxsfbbfbvjjanllnlvhhqdffdfvttylpplp
vffgtzztzvrrobjjbjvddwjttjtvpperddrdwccnaooaowooviyyiywaadqiiqiwmmlyssys
wyytgccgcwkkbommomwiireggegwuuzmqqmqwgghuaauawsspckkckweexkuukuwqqfseese
xddobppbpxppwjzzjzxbberjjrjxnnmzttztxzzuhddhdxllcpnnpnxjjsfhhfhxvvanrrnr
xhhivbbvbxttqdlldlxffylvvlvxrrgtfftfyeepcqqcqyqqxkaakayccfskkskyoonauuau
yaavieeieymmdqooqoykktgiigiywwbossosyiijwccwcyuuremmemyggzmwwmwysshuggug
zffqdrrdrzrrylbblbzddgtlltlzppobvvbvzbbwjffjfznnerpprpzlluhjjhjzxxcpttpt
zjjkxddxdzvvsfnnfnzhhanxxnxzttivhhvhaggressesasszmccmcaeehummumaqqpcwwcw
accxkggkgaoofsqqsqammvikkikayydquuquakklyeeyeawwtgoogoaiiboyyoyauujwiiwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: aggresses
Cipher: ntterffrf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: aggresses
Cipher: 112222245134345134

Extended Methods:
Method #1

Plaintext: aggresses
method variations:
fmmwkxxkxlrrbpccpcqwwguhhuhvbbmznnzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a g g r e s s e s 
1 2 2 2 5 3 3 5 3 
1 2 2 4 1 4 4 1 4 
They are then read out in rows:
122253353122414414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: aggresses
Cipher: fgpxcgdtq

Read more ...
Method #3

Plaintext: aggresses
method variations:
fggyloyld ggyloyldf gyloyldfg
yloyldfgg loyldfggy oyldfggyl
yldfggylo ldfggyloy dfggyloyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: aggresses

first 5040 cipher variations(362880 total)
aggresses aggressse aggresess aggresess aggresses aggressse aggresses aggressse aggresess aggresess aggresses
aggressse aggreesss aggreesss aggreesss aggreesss aggreesss aggreesss aggresses aggressse aggresess aggresess
aggresses aggressse aggrseses aggrsesse aggrseess aggrseess aggrseses aggrsesse aggrssees aggrssese aggrssees
aggrssese aggrsssee aggrsssee aggrseses aggrsesse aggrseess aggrseess aggrseses aggrsesse aggrsssee aggrsssee
aggrssese aggrssees aggrssees aggrssese aggrssees aggrssese aggrssees aggrssese aggrsssee aggrsssee aggrseses
aggrsesse aggrseess aggrseess aggrseses aggrsesse aggrseess aggrseess aggrseses aggrsesse aggrsesse aggrseses
aggrssees aggrssese aggrssees aggrssese aggrsssee aggrsssee aggresses aggressse aggresess aggresess aggresses
aggressse aggresses aggressse aggresess aggresess aggresses aggressse aggreesss aggreesss aggreesss aggreesss
aggreesss aggreesss aggresses aggressse aggresess aggresess aggresses aggressse aggrsssee aggrsssee aggrssese
aggrssees aggrssees aggrssese aggrsssee aggrsssee aggrssese aggrssees aggrssees aggrssese aggrsesse aggrseses
aggrsesse aggrseses aggrseess aggrseess aggrseses aggrsesse aggrseess aggrseess aggrseses aggrsesse aggersses
aggerssse aggersess aggersess aggersses aggerssse aggersses aggerssse aggersess aggersess aggersses aggerssse
aggeresss aggeresss aggeresss aggeresss aggeresss aggeresss aggersses aggerssse aggersess aggersess aggersses
aggerssse aggesrses aggesrsse aggesress aggesress aggesrses aggesrsse aggessres aggessrse aggessers aggessesr
aggessser aggesssre aggesesrs aggesessr aggeserss aggeserss aggesesrs aggesessr aggessser aggesssre aggessesr
aggessers aggessres aggessrse aggessres aggessrse aggessers aggessesr aggessser aggesssre aggesrses aggesrsse
aggesress aggesress aggesrses aggesrsse aggeserss aggeserss aggesesrs aggesessr aggesessr aggesesrs aggessres
aggessrse aggessers aggessesr aggessser aggesssre aggeessrs aggeesssr aggeesrss aggeesrss aggeessrs aggeesssr
aggeessrs aggeesssr aggeesrss aggeesrss aggeessrs aggeesssr aggeersss aggeersss aggeersss aggeersss aggeersss
aggeersss aggeessrs aggeesssr aggeesrss aggeesrss aggeessrs aggeesssr aggessser aggesssre aggessesr aggessers
aggessres aggessrse aggessser aggesssre aggessesr aggessers aggessres aggessrse aggesessr aggesesrs aggesessr
aggesesrs aggeserss aggeserss aggesrses aggesrsse aggesress aggesress aggesrses aggesrsse aggserses aggsersse
aggseress aggseress aggserses aggsersse aggsesres aggsesrse aggsesers aggsesesr aggsesser aggsessre aggseesrs
aggseessr aggseerss aggseerss aggseesrs aggseessr aggsesser aggsessre aggsesesr aggsesers aggsesres aggsesrse
aggsreses aggsresse aggsreess aggsreess aggsreses aggsresse aggsrsees aggsrsese aggsrsees aggsrsese aggsrssee
aggsrssee aggsreses aggsresse aggsreess aggsreess aggsreses aggsresse aggsrssee aggsrssee aggsrsese aggsrsees
aggsrsees aggsrsese aggssrees aggssrese aggssrees aggssrese aggssrsee aggssrsee aggsseres aggsserse aggsseers
aggsseesr aggsseser aggssesre aggsseers aggsseesr aggsseres aggsserse aggssesre aggsseser aggssseer aggsssere
aggssseer aggsssere aggsssree aggsssree aggserses aggsersse aggseress aggseress aggserses aggsersse aggsesres
aggsesrse aggsesers aggsesesr aggsesser aggsessre aggseesrs aggseessr aggseerss aggseerss aggseesrs aggseessr
aggsesser aggsessre aggsesesr aggsesers aggsesres aggsesrse aggssrsee aggssrsee aggssrese aggssrees aggssrees
aggssrese aggsssree aggsssree aggsssere aggssseer aggssseer aggsssere aggssesre aggsseser aggsserse aggsseres
aggsseers aggsseesr aggsseser aggssesre aggsseesr aggsseers aggsseres aggsserse aggsesres aggsesrse aggsesers
aggsesesr aggsesser aggsessre aggserses aggsersse aggseress aggseress aggserses aggsersse aggseerss aggseerss
aggseesrs aggseessr aggseessr aggseesrs aggsesres aggsesrse aggsesers aggsesesr aggsesser aggsessre aggsseres
aggsserse aggsseers aggsseesr aggsseser aggssesre aggssrees aggssrese aggssrees aggssrese aggssrsee aggssrsee
aggsseres aggsserse aggsseers aggsseesr aggsseser aggssesre aggsssree aggsssree aggsssere aggssseer aggssseer
aggsssere aggsrsees aggsrsese aggsrsees aggsrsese aggsrssee aggsrssee aggsreses aggsresse aggsreess aggsreess
aggsreses aggsresse aggsreess aggsreess aggsreses aggsresse aggsresse aggsreses aggsrsees aggsrsese aggsrsees
aggsrsese aggsrssee aggsrssee aggsesres aggsesrse aggsesers aggsesesr aggsesser aggsessre aggserses aggsersse
aggseress aggseress aggserses aggsersse aggseerss aggseerss aggseesrs aggseessr aggseessr aggseesrs aggsesres
aggsesrse aggsesers aggsesesr aggsesser aggsessre aggsssree aggsssree aggsssere aggssseer aggssseer aggsssere
aggssrsee aggssrsee aggssrese aggssrees aggssrees aggssrese aggsserse aggsseres aggssesre aggsseser aggsseesr
aggsseers aggsseres aggsserse aggsseers aggsseesr aggsseser aggssesre aggeessrs aggeesssr aggeesrss aggeesrss
aggeessrs aggeesssr aggeessrs aggeesssr aggeesrss aggeesrss aggeessrs aggeesssr aggeersss aggeersss aggeersss
aggeersss aggeersss aggeersss aggeessrs aggeesssr aggeesrss aggeesrss aggeessrs aggeesssr aggesesrs aggesessr
aggeserss aggeserss aggesesrs aggesessr aggessers aggessesr aggessres aggessrse aggesssre aggessser aggesrses
aggesrsse aggesress aggesress aggesrses aggesrsse aggesssre aggessser aggessrse aggessres aggessers aggessesr
aggessers aggessesr aggessres aggessrse aggesssre aggessser aggesesrs aggesessr aggeserss aggeserss aggesesrs
aggesessr aggesress aggesress aggesrses aggesrsse aggesrsse aggesrses aggessers aggessesr aggessres aggessrse
aggesssre aggessser aggersses aggerssse aggersess aggersess aggersses aggerssse aggersses aggerssse aggersess
aggersess aggersses aggerssse aggeresss aggeresss aggeresss aggeresss aggeresss aggeresss aggersses aggerssse
aggersess aggersess aggersses aggerssse aggesssre aggessser aggessrse aggessres aggessers aggessesr aggesssre
aggessser aggessrse aggessres aggessers aggessesr aggesrsse aggesrses aggesrsse aggesrses aggesress aggesress
aggesesrs aggesessr aggeserss aggeserss aggesesrs aggesessr aggsesser aggsessre aggsesesr aggsesers aggsesres
aggsesrse aggsesser aggsessre aggsesesr aggsesers aggsesres aggsesrse aggseessr aggseesrs aggseessr aggseesrs
aggseerss aggseerss aggserses aggsersse aggseress aggseress aggserses aggsersse aggsseser aggssesre aggsseesr
aggsseers aggsseres aggsserse aggssseer aggsssere aggssseer aggsssere aggsssree aggsssree aggsseser aggssesre
aggsseesr aggsseers aggsseres aggsserse aggssrsee aggssrsee aggssrese aggssrees aggssrees aggssrese aggssseer
aggsssere aggssseer aggsssere aggsssree aggsssree aggsseser aggssesre aggsseesr aggsseers aggsseres aggsserse
aggsseesr aggsseers aggsseser aggssesre aggsserse aggsseres aggssrees aggssrese aggssrees aggssrese aggssrsee
aggssrsee aggsesser aggsessre aggsesesr aggsesers aggsesres aggsesrse aggsesser aggsessre aggsesesr aggsesers
aggsesres aggsesrse aggseessr aggseesrs aggseessr aggseesrs aggseerss aggseerss aggserses aggsersse aggseress
aggseress aggserses aggsersse aggsrssee aggsrssee aggsrsese aggsrsees aggsrsees aggsrsese aggsrssee aggsrssee
aggsrsese aggsrsees aggsrsees aggsrsese aggsresse aggsreses aggsresse aggsreses aggsreess aggsreess aggsreses
aggsresse aggsreess aggsreess aggsreses aggsresse agrgesses agrgessse agrgesess agrgesess agrgesses agrgessse
agrgesses agrgessse agrgesess agrgesess agrgesses agrgessse agrgeesss agrgeesss agrgeesss agrgeesss agrgeesss
agrgeesss agrgesses agrgessse agrgesess agrgesess agrgesses agrgessse agrgseses agrgsesse agrgseess agrgseess
agrgseses agrgsesse agrgssees agrgssese agrgssees agrgssese agrgsssee agrgsssee agrgseses agrgsesse agrgseess
agrgseess agrgseses agrgsesse agrgsssee agrgsssee agrgssese agrgssees agrgssees agrgssese agrgssees agrgssese
agrgssees agrgssese agrgsssee agrgsssee agrgseses agrgsesse agrgseess agrgseess agrgseses agrgsesse agrgseess
agrgseess agrgseses agrgsesse agrgsesse agrgseses agrgssees agrgssese agrgssees agrgssese agrgsssee agrgsssee
agrgesses agrgessse agrgesess agrgesess agrgesses agrgessse agrgesses agrgessse agrgesess agrgesess agrgesses
agrgessse agrgeesss agrgeesss agrgeesss agrgeesss agrgeesss agrgeesss agrgesses agrgessse agrgesess agrgesess
agrgesses agrgessse agrgsssee agrgsssee agrgssese agrgssees agrgssees agrgssese agrgsssee agrgsssee agrgssese
agrgssees agrgssees agrgssese agrgsesse agrgseses agrgsesse agrgseses agrgseess agrgseess agrgseses agrgsesse
agrgseess agrgseess agrgseses agrgsesse agregsses agregssse agregsess agregsess agregsses agregssse agregsses
agregssse agregsess agregsess agregsses agregssse agregesss agregesss agregesss agregesss agregesss agregesss
agregsses agregssse agregsess agregsess agregsses agregssse agresgses agresgsse agresgess agresgess agresgses
agresgsse agressges agressgse agressegs agressesg agressseg agresssge agresesgs agresessg agresegss agresegss
agresesgs agresessg agressseg agresssge agressesg agressegs agressges agressgse agressges agressgse agressegs
agressesg agressseg agresssge agresgses agresgsse agresgess agresgess agresgses agresgsse agresegss agresegss
agresesgs agresessg agresessg agresesgs agressges agressgse agressegs agressesg agressseg agresssge agreessgs
agreesssg agreesgss agreesgss agreessgs agreesssg agreessgs agreesssg agreesgss agreesgss agreessgs agreesssg
agreegsss agreegsss agreegsss agreegsss agreegsss agreegsss agreessgs agreesssg agreesgss agreesgss agreessgs
agreesssg agressseg agresssge agressesg agressegs agressges agressgse agressseg agresssge agressesg agressegs
agressges agressgse agresessg agresesgs agresessg agresesgs agresegss agresegss agresgses agresgsse agresgess
agresgess agresgses agresgsse agrsegses agrsegsse agrsegess agrsegess agrsegses agrsegsse agrsesges agrsesgse
agrsesegs agrsesesg agrsesseg agrsessge agrseesgs agrseessg agrseegss agrseegss agrseesgs agrseessg agrsesseg
agrsessge agrsesesg agrsesegs agrsesges agrsesgse agrsgeses agrsgesse agrsgeess agrsgeess agrsgeses agrsgesse
agrsgsees agrsgsese agrsgsees agrsgsese agrsgssee agrsgssee agrsgeses agrsgesse agrsgeess agrsgeess agrsgeses
agrsgesse agrsgssee agrsgssee agrsgsese agrsgsees agrsgsees agrsgsese agrssgees agrssgese agrssgees agrssgese
agrssgsee agrssgsee agrsseges agrssegse agrsseegs agrsseesg agrsseseg agrssesge agrsseegs agrsseesg agrsseges
agrssegse agrssesge agrsseseg agrssseeg agrsssege agrssseeg agrsssege agrsssgee agrsssgee agrsegses agrsegsse
agrsegess agrsegess agrsegses agrsegsse agrsesges agrsesgse agrsesegs agrsesesg agrsesseg agrsessge agrseesgs
agrseessg agrseegss agrseegss agrseesgs agrseessg agrsesseg agrsessge agrsesesg agrsesegs agrsesges agrsesgse
agrssgsee agrssgsee agrssgese agrssgees agrssgees agrssgese agrsssgee agrsssgee agrsssege agrssseeg agrssseeg
agrsssege agrssesge agrsseseg agrssegse agrsseges agrsseegs agrsseesg agrsseseg agrssesge agrsseesg agrsseegs
agrsseges agrssegse agrsesges agrsesgse agrsesegs agrsesesg agrsesseg agrsessge agrsegses agrsegsse agrsegess
agrsegess agrsegses agrsegsse agrseegss agrseegss agrseesgs agrseessg agrseessg agrseesgs agrsesges agrsesgse
agrsesegs agrsesesg agrsesseg agrsessge agrsseges agrssegse agrsseegs agrsseesg agrsseseg agrssesge agrssgees
agrssgese agrssgees agrssgese agrssgsee agrssgsee agrsseges agrssegse agrsseegs agrsseesg agrsseseg agrssesge
agrsssgee agrsssgee agrsssege agrssseeg agrssseeg agrsssege agrsgsees agrsgsese agrsgsees agrsgsese agrsgssee
agrsgssee agrsgeses agrsgesse agrsgeess agrsgeess agrsgeses agrsgesse agrsgeess agrsgeess agrsgeses agrsgesse
agrsgesse agrsgeses agrsgsees agrsgsese agrsgsees agrsgsese agrsgssee agrsgssee agrsesges agrsesgse agrsesegs
agrsesesg agrsesseg agrsessge agrsegses agrsegsse agrsegess agrsegess agrsegses agrsegsse agrseegss agrseegss
agrseesgs agrseessg agrseessg agrseesgs agrsesges agrsesgse agrsesegs agrsesesg agrsesseg agrsessge agrsssgee
agrsssgee agrsssege agrssseeg agrssseeg agrsssege agrssgsee agrssgsee agrssgese agrssgees agrssgees agrssgese
agrssegse agrsseges agrssesge agrsseseg agrsseesg agrsseegs agrsseges agrssegse agrsseegs agrsseesg agrsseseg
agrssesge agreessgs agreesssg agreesgss agreesgss agreessgs agreesssg agreessgs agreesssg agreesgss agreesgss
agreessgs agreesssg agreegsss agreegsss agreegsss agreegsss agreegsss agreegsss agreessgs agreesssg agreesgss
agreesgss agreessgs agreesssg agresesgs agresessg agresegss agresegss agresesgs agresessg agressegs agressesg
agressges agressgse agresssge agressseg agresgses agresgsse agresgess agresgess agresgses agresgsse agresssge
agressseg agressgse agressges agressegs agressesg agressegs agressesg agressges agressgse agresssge agressseg
agresesgs agresessg agresegss agresegss agresesgs agresessg agresgess agresgess agresgses agresgsse agresgsse
agresgses agressegs agressesg agressges agressgse agresssge agressseg agregsses agregssse agregsess agregsess
agregsses agregssse agregsses agregssse agregsess agregsess agregsses agregssse agregesss agregesss agregesss
agregesss agregesss agregesss agregsses agregssse agregsess agregsess agregsses agregssse agresssge agressseg
agressgse agressges agressegs agressesg agresssge agressseg agressgse agressges agressegs agressesg agresgsse
agresgses agresgsse agresgses agresgess agresgess agresesgs agresessg agresegss agresegss agresesgs agresessg
agrsesseg agrsessge agrsesesg agrsesegs agrsesges agrsesgse agrsesseg agrsessge agrsesesg agrsesegs agrsesges
agrsesgse agrseessg agrseesgs agrseessg agrseesgs agrseegss agrseegss agrsegses agrsegsse agrsegess agrsegess
agrsegses agrsegsse agrsseseg agrssesge agrsseesg agrsseegs agrsseges agrssegse agrssseeg agrsssege agrssseeg
agrsssege agrsssgee agrsssgee agrsseseg agrssesge agrsseesg agrsseegs agrsseges agrssegse agrssgsee agrssgsee
agrssgese agrssgees agrssgees agrssgese agrssseeg agrsssege agrssseeg agrsssege agrsssgee agrsssgee agrsseseg
agrssesge agrsseesg agrsseegs agrsseges agrssegse agrsseesg agrsseegs agrsseseg agrssesge agrssegse agrsseges
agrssgees agrssgese agrssgees agrssgese agrssgsee agrssgsee agrsesseg agrsessge agrsesesg agrsesegs agrsesges
agrsesgse agrsesseg agrsessge agrsesesg agrsesegs agrsesges agrsesgse agrseessg agrseesgs agrseessg agrseesgs
agrseegss agrseegss agrsegses agrsegsse agrsegess agrsegess agrsegses agrsegsse agrsgssee agrsgssee agrsgsese
agrsgsees agrsgsees agrsgsese agrsgssee agrsgssee agrsgsese agrsgsees agrsgsees agrsgsese agrsgesse agrsgeses
agrsgesse agrsgeses agrsgeess agrsgeess agrsgeses agrsgesse agrsgeess agrsgeess agrsgeses agrsgesse agergsses
agergssse agergsess agergsess agergsses agergssse agergsses agergssse agergsess agergsess agergsses agergssse
agergesss agergesss agergesss agergesss agergesss agergesss agergsses agergssse agergsess agergsess agergsses
agergssse agersgses agersgsse agersgess agersgess agersgses agersgsse agerssges agerssgse agerssegs agerssesg
agerssseg agersssge agersesgs agersessg agersegss agersegss agersesgs agersessg agerssseg agersssge agerssesg
agerssegs agerssges agerssgse agerssges agerssgse agerssegs agerssesg agerssseg agersssge agersgses agersgsse
agersgess agersgess agersgses agersgsse agersegss agersegss agersesgs agersessg agersessg agersesgs agerssges
agerssgse agerssegs agerssesg agerssseg agersssge ageressgs ageresssg ageresgss ageresgss ageressgs ageresssg
ageressgs ageresssg ageresgss ageresgss ageressgs ageresssg ageregsss ageregsss ageregsss ageregsss ageregsss
ageregsss ageressgs ageresssg ageresgss ageresgss ageressgs ageresssg agerssseg agersssge agerssesg agerssegs
agerssges agerssgse agerssseg agersssge agerssesg agerssegs agerssges agerssgse agersessg agersesgs agersessg
agersesgs agersegss agersegss agersgses agersgsse agersgess agersgess agersgses agersgsse agegrsses agegrssse
agegrsess agegrsess agegrsses agegrssse agegrsses agegrssse agegrsess agegrsess agegrsses agegrssse agegresss
agegresss agegresss agegresss agegresss agegresss agegrsses agegrssse agegrsess agegrsess agegrsses agegrssse
agegsrses agegsrsse agegsress agegsress agegsrses agegsrsse agegssres agegssrse agegssers agegssesr agegssser
agegsssre agegsesrs agegsessr agegserss agegserss agegsesrs agegsessr agegssser agegsssre agegssesr agegssers
agegssres agegssrse agegssres agegssrse agegssers agegssesr agegssser agegsssre agegsrses agegsrsse agegsress
agegsress agegsrses agegsrsse agegserss agegserss agegsesrs agegsessr agegsessr agegsesrs agegssres agegssrse
agegssers agegssesr agegssser agegsssre agegessrs agegesssr agegesrss agegesrss agegessrs agegesssr agegessrs
agegesssr agegesrss agegesrss agegessrs agegesssr agegersss agegersss agegersss agegersss agegersss agegersss
agegessrs agegesssr agegesrss agegesrss agegessrs agegesssr agegssser agegsssre agegssesr agegssers agegssres
agegssrse agegssser agegsssre agegssesr agegssers agegssres agegssrse agegsessr agegsesrs agegsessr agegsesrs
agegserss agegserss agegsrses agegsrsse agegsress agegsress agegsrses agegsrsse agesgrses agesgrsse agesgress
agesgress agesgrses agesgrsse agesgsres agesgsrse agesgsers agesgsesr agesgsser agesgssre agesgesrs agesgessr
agesgerss agesgerss agesgesrs agesgessr agesgsser agesgssre agesgsesr agesgsers agesgsres agesgsrse agesrgses
agesrgsse agesrgess agesrgess agesrgses agesrgsse agesrsges agesrsgse agesrsegs agesrsesg agesrsseg agesrssge
agesresgs agesressg agesregss agesregss agesresgs agesressg agesrsseg agesrssge agesrsesg agesrsegs agesrsges
agesrsgse agessrges agessrgse agessregs agessresg agessrseg agessrsge agessgres agessgrse agessgers agessgesr
agessgser agessgsre agessegrs agessegsr agessergs agessersg agessesrg agessesgr agesssger agesssgre agesssegr
agessserg agesssreg agesssrge agesersgs ageserssg agesergss agesergss agesersgs ageserssg agesesrgs agesesrsg
agesesgrs agesesgsr agesessgr agesessrg agesegsrs agesegssr agesegrss agesegrss agesegsrs agesegssr agesessgr
agesessrg agesesgsr agesesgrs agesesrgs agesesrsg agessrseg agessrsge agessresg agessregs agessrges agessrgse
agesssreg agesssrge agessserg agesssegr agesssger agesssgre agessesrg agessesgr agessersg agessergs agessegrs
agessegsr agessgser agessgsre agessgesr agessgers agessgres agessgrse agesgsres agesgsrse agesgsers agesgsesr
agesgsser agesgssre agesgrses agesgrsse agesgress agesgress agesgrses agesgrsse agesgerss agesgerss agesgesrs
agesgessr agesgessr agesgesrs agesgsres agesgsrse agesgsers agesgsesr agesgsser agesgssre agessgres agessgrse
agessgers agessgesr agessgser agessgsre agessrges agessrgse agessregs agessresg agessrseg agessrsge agessergs
agessersg agessegrs agessegsr agessesgr agessesrg agesssreg agesssrge agessserg agesssegr agesssger agesssgre
agesrsges agesrsgse agesrsegs agesrsesg agesrsseg agesrssge agesrgses agesrgsse agesrgess agesrgess agesrgses
agesrgsse agesregss agesregss agesresgs agesressg agesressg agesresgs agesrsges agesrsgse agesrsegs agesrsesg
agesrsseg agesrssge agesesrgs agesesrsg agesesgrs agesesgsr agesessgr agesessrg agesersgs ageserssg agesergss
agesergss agesersgs ageserssg agesegrss agesegrss agesegsrs agesegssr agesegssr agesegsrs agesesrgs agesesrsg
agesesgrs agesesgsr agesessgr agesessrg agesssreg agesssrge agessserg agesssegr agesssger agesssgre agessrseg
agessrsge agessresg agessregs agessrges agessrgse agessersg agessergs agessesrg agessesgr agessegsr agessegrs
agessgres agessgrse agessgers agessgesr agessgser agessgsre ageegssrs ageegsssr ageegsrss ageegsrss ageegssrs
ageegsssr ageegssrs ageegsssr ageegsrss ageegsrss ageegssrs ageegsssr ageegrsss ageegrsss ageegrsss ageegrsss
ageegrsss ageegrsss ageegssrs ageegsssr ageegsrss ageegsrss ageegssrs ageegsssr ageesgsrs ageesgssr ageesgrss
ageesgrss ageesgsrs ageesgssr ageessgrs ageessgsr ageessrgs ageessrsg ageesssrg ageesssgr ageesrsgs ageesrssg
ageesrgss ageesrgss ageesrsgs ageesrssg ageesssrg ageesssgr ageessrsg ageessrgs ageessgrs ageessgsr ageessgrs
ageessgsr ageessrgs ageessrsg ageesssrg ageesssgr ageesgsrs ageesgssr ageesgrss ageesgrss ageesgsrs ageesgssr
ageesrgss ageesrgss ageesrsgs ageesrssg ageesrssg ageesrsgs ageessgrs ageessgsr ageessrgs ageessrsg ageesssrg
ageesssgr ageerssgs ageersssg ageersgss ageersgss ageerssgs ageersssg ageerssgs ageersssg ageersgss ageersgss
ageerssgs ageersssg ageergsss ageergsss ageergsss ageergsss ageergsss ageergsss ageerssgs ageersssg ageersgss
ageersgss ageerssgs ageersssg ageesssrg ageesssgr ageessrsg ageessrgs ageessgrs ageessgsr ageesssrg ageesssgr
ageessrsg ageessrgs ageessgrs ageessgsr ageesrssg ageesrsgs ageesrssg ageesrsgs ageesrgss ageesrgss ageesgsrs
ageesgssr ageesgrss ageesgrss ageesgsrs ageesgssr agesgsser agesgssre agesgsesr agesgsers agesgsres agesgsrse
agesgsser agesgssre agesgsesr agesgsers agesgsres agesgsrse agesgessr agesgesrs agesgessr agesgesrs agesgerss
agesgerss agesgrses agesgrsse agesgress agesgress agesgrses agesgrsse agessgser agessgsre agessgesr agessgers
agessgres agessgrse agesssger agesssgre agesssegr agessserg agesssreg agesssrge agessesgr agessesrg agessegsr
agessegrs agessergs agessersg agessrseg agessrsge agessresg agessregs agessrges agessrgse agesssger agesssgre
agesssegr agessserg agesssreg agesssrge agessgser agessgsre agessgesr agessgers agessgres agessgrse agessegsr
agessegrs agessesgr agessesrg agessersg agessergs agessrges agessrgse agessregs agessresg agessrseg agessrsge
agesessgr agesessrg agesesgsr agesesgrs agesesrgs agesesrsg agesessgr agesessrg agesesgsr agesesgrs agesesrgs
agesesrsg agesegssr agesegsrs agesegssr agesegsrs agesegrss agesegrss agesersgs ageserssg agesergss agesergss
agesersgs ageserssg agesrsseg agesrssge agesrsesg agesrsegs agesrsges agesrsgse agesrsseg agesrssge agesrsesg
agesrsegs agesrsges agesrsgse agesressg agesresgs agesressg agesresgs agesregss agesregss agesrgses agesrgsse
agesrgess agesrgess agesrgses agesrgsse agsregses agsregsse agsregess agsregess agsregses agsregsse agsresges
agsresgse agsresegs agsresesg agsresseg agsressge agsreesgs agsreessg agsreegss agsreegss agsreesgs agsreessg
agsresseg agsressge agsresesg agsresegs agsresges agsresgse agsrgeses agsrgesse agsrgeess agsrgeess agsrgeses
agsrgesse agsrgsees agsrgsese agsrgsees agsrgsese agsrgssee agsrgssee agsrgeses agsrgesse agsrgeess agsrgeess
agsrgeses agsrgesse agsrgssee agsrgssee agsrgsese agsrgsees agsrgsees agsrgsese agsrsgees agsrsgese agsrsgees
agsrsgese agsrsgsee agsrsgsee agsrseges agsrsegse agsrseegs agsrseesg agsrseseg agsrsesge agsrseegs agsrseesg
agsrseges agsrsegse agsrsesge agsrseseg agsrsseeg agsrssege agsrsseeg agsrssege agsrssgee agsrssgee agsregses
agsregsse agsregess agsregess agsregses agsregsse agsresges agsresgse agsresegs agsresesg agsresseg agsressge
agsreesgs agsreessg agsreegss agsreegss agsreesgs agsreessg agsresseg agsressge agsresesg agsresegs agsresges
agsresgse agsrsgsee agsrsgsee agsrsgese agsrsgees agsrsgees agsrsgese agsrssgee agsrssgee agsrssege agsrsseeg
agsrsseeg agsrssege agsrsesge agsrseseg agsrsegse agsrseges agsrseegs agsrseesg agsrseseg agsrsesge agsrseesg
agsrseegs agsrseges agsrsegse agsergses agsergsse agsergess agsergess agsergses agsergsse agsersges agsersgse
agsersegs agsersesg agsersseg agserssge agseresgs agseressg agseregss agseregss agseresgs agseressg agsersseg
agserssge agsersesg agsersegs agsersges agsersgse agsegrses agsegrsse agsegress agsegress agsegrses agsegrsse
agsegsres agsegsrse agsegsers agsegsesr agsegsser agsegssre agsegesrs agsegessr agsegerss agsegerss agsegesrs
agsegessr agsegsser agsegssre agsegsesr agsegsers agsegsres agsegsrse agsesgres agsesgrse agsesgers agsesgesr
agsesgser agsesgsre agsesrges agsesrgse agsesregs agsesresg agsesrseg agsesrsge agsesergs agsesersg agsesegrs
agsesegsr agsesesgr agsesesrg agsessreg agsessrge agsesserg agsessegr agsessger agsessgre agseegsrs agseegssr
agseegrss agseegrss agseegsrs agseegssr agseesgrs agseesgsr agseesrgs agseesrsg agseessrg agseessgr agseersgs
agseerssg agseergss agseergss agseersgs agseerssg agseessrg agseessgr agseesrsg agseesrgs agseesgrs agseesgsr
agsesgser agsesgsre agsesgesr agsesgers agsesgres agsesgrse agsessger agsessgre agsessegr agsesserg agsessreg
agsessrge agsesesgr agsesesrg agsesegsr agsesegrs agsesergs agsesersg agsesrseg agsesrsge agsesresg agsesregs
agsesrges agsesrgse agsgerses agsgersse agsgeress agsgeress agsgerses agsgersse agsgesres agsgesrse agsgesers
agsgesesr agsgesser agsgessre agsgeesrs agsgeessr agsgeerss agsgeerss agsgeesrs agsgeessr agsgesser agsgessre
agsgesesr agsgesers agsgesres agsgesrse agsgreses agsgresse agsgreess agsgreess agsgreses agsgresse agsgrsees
agsgrsese agsgrsees agsgrsese agsgrssee agsgrssee agsgreses agsgresse agsgreess agsgreess agsgreses agsgresse
agsgrssee agsgrssee agsgrsese agsgrsees agsgrsees agsgrsese agsgsrees agsgsrese agsgsrees agsgsrese agsgsrsee
agsgsrsee agsgseres agsgserse agsgseers agsgseesr agsgseser agsgsesre agsgseers agsgseesr agsgseres agsgserse
agsgsesre agsgseser agsgsseer agsgssere agsgsseer agsgssere agsgssree agsgssree agsgerses agsgersse agsgeress
agsgeress agsgerses agsgersse agsgesres agsgesrse agsgesers agsgesesr agsgesser agsgessre agsgeesrs agsgeessr
agsgeerss agsgeerss agsgeesrs agsgeessr agsgesser agsgessre agsgesesr agsgesers agsgesres agsgesrse agsgsrsee
agsgsrsee agsgsrese agsgsrees agsgsrees agsgsrese agsgssree agsgssree agsgssere agsgsseer agsgsseer agsgssere
agsgsesre agsgseser agsgserse agsgseres agsgseers agsgseesr agsgseser agsgsesre agsgseesr agsgseers agsgseres
agsgserse agssegres agssegrse agssegers agssegesr agssegser agssegsre agsserges agssergse agsseregs agsseresg
agsserseg agssersge agsseergs agsseersg agsseegrs agsseegsr agsseesgr agsseesrg agssesreg agssesrge agsseserg
agssesegr agssesger agssesgre agssgeres agssgerse agssgeers agssgeesr agssgeser agssgesre agssgrees agssgrese
agssgrees agssgrese agssgrsee agssgrsee agssgeres agssgerse agssgeers agssgeesr agssgeser agssgesre agssgsree
agssgsree agssgsere agssgseer agssgseer agssgsere agssrgees agssrgese agssrgees agssrgese agssrgsee agssrgsee
agssreges agssregse agssreegs agssreesg agssreseg agssresge agssreegs agssreesg agssreges agssregse agssresge
agssreseg agssrseeg agssrsege agssrseeg agssrsege agssrsgee agssrsgee agssegres agssegrse agssegers agssegesr
agssegser agssegsre agsserges agssergse agsseregs agsseresg agsserseg agssersge agsseergs agsseersg agsseegrs
agsseegsr agsseesgr agsseesrg agssesreg agssesrge agsseserg agssesegr agssesger agssesgre agsssgree agsssgree
agsssgere agsssgeer agsssgeer agsssgere agsssrgee agsssrgee agsssrege agsssreeg agsssreeg agsssrege agssserge
agsssereg agsssegre agssseger agssseegr agssseerg agsssereg agssserge agssseerg agssseegr agssseger agsssegre
agseegsrs agseegssr agseegrss agseegrss agseegsrs agseegssr agseesgrs agseesgsr agseesrgs agseesrsg agseessrg
agseessgr agseersgs agseerssg agseergss agseergss agseersgs agseerssg agseessrg agseessgr agseesrsg agseesrgs
agseesgrs agseesgsr agsegesrs agsegessr agsegerss agsegerss agsegesrs agsegessr agsegsers agsegsesr agsegsres
agsegsrse agsegssre agsegsser agsegrses agsegrsse agsegress agsegress agsegrses agsegrsse agsegssre agsegsser
agsegsrse agsegsres agsegsers agsegsesr agsesgers agsesgesr agsesgres agsesgrse agsesgsre agsesgser agsesegrs
agsesegsr agsesergs agsesersg agsesesrg agsesesgr agsesregs agsesresg agsesrges agsesrgse agsesrsge agsesrseg
agsesserg agsessegr agsessreg agsessrge agsessgre agsessger agsergses agsergsse agsergess agsergess agsergses
agsergsse agsersges agsersgse agsersegs agsersesg agsersseg agserssge agseresgs agseressg agseregss agseregss
agseresgs agseressg agsersseg agserssge agsersesg agsersegs agsersges agsersgse agsesgsre agsesgser agsesgrse
agsesgres agsesgers agsesgesr agsessgre agsessger agsessrge agsessreg agsesserg agsessegr agsesrsge agsesrseg
agsesrgse agsesrges agsesregs agsesresg agsesesrg agsesesgr agsesersg agsesergs agsesegrs agsesegsr agssegser
agssegsre agssegesr agssegers agssegres agssegrse agssesger agssesgre agssesegr agsseserg agssesreg agssesrge
agsseesgr agsseesrg agsseegsr agsseegrs agsseergs agsseersg agsserseg agssersge agsseresg agsseregs agsserges
agssergse agssgeser agssgesre agssgeesr agssgeers agssgeres agssgerse agssgseer agssgsere agssgseer agssgsere
agssgsree agssgsree agssgeser agssgesre agssgeesr agssgeers agssgeres agssgerse agssgrsee agssgrsee agssgrese
agssgrees agssgrees agssgrese agsssgeer agsssgere agsssgeer agsssgere agsssgree agsssgree agssseger agsssegre
agssseegr agssseerg agsssereg agssserge agssseegr agssseerg agssseger agsssegre agssserge agsssereg agsssreeg
agsssrege agsssreeg agsssrege agsssrgee agsssrgee agssegser agssegsre agssegesr agssegers agssegres agssegrse
agssesger agssesgre agssesegr agsseserg agssesreg agssesrge agsseesgr agsseesrg agsseegsr agsseegrs agsseergs
agsseersg agsserseg agssersge agsseresg agsseregs agsserges agssergse agssrgsee agssrgsee agssrgese agssrgees
agssrgees agssrgese agssrsgee agssrsgee agssrsege agssrseeg agssrseeg agssrsege agssresge agssreseg agssregse
agssreges agssreegs agssreesg agssreseg agssresge agssreesg agssreegs agssreges agssregse agsresges agsresgse
agsresegs agsresesg agsresseg agsressge agsregses agsregsse agsregess agsregess agsregses agsregsse agsreegss
agsreegss agsreesgs agsreessg agsreessg agsreesgs agsresges agsresgse agsresegs agsresesg agsresseg agsressge
agsrseges agsrsegse agsrseegs agsrseesg agsrseseg agsrsesge agsrsgees agsrsgese agsrsgees agsrsgese agsrsgsee
agsrsgsee agsrseges agsrsegse agsrseegs agsrseesg agsrseseg agsrsesge agsrssgee agsrssgee agsrssege agsrsseeg
agsrsseeg agsrssege agsrgsees agsrgsese agsrgsees agsrgsese agsrgssee agsrgssee agsrgeses agsrgesse agsrgeess
agsrgeess agsrgeses agsrgesse agsrgeess agsrgeess agsrgeses agsrgesse agsrgesse agsrgeses agsrgsees agsrgsese
agsrgsees agsrgsese agsrgssee agsrgssee agsresges agsresgse agsresegs agsresesg agsresseg agsressge agsregses
agsregsse agsregess agsregess agsregses agsregsse agsreegss agsreegss agsreesgs agsreessg agsreessg agsreesgs
agsresges agsresgse agsresegs agsresesg agsresseg agsressge agsrssgee agsrssgee agsrssege agsrsseeg agsrsseeg
agsrssege agsrsgsee agsrsgsee agsrsgese agsrsgees agsrsgees agsrsgese agsrsegse agsrseges agsrsesge agsrseseg
agsrseesg agsrseegs agsrseges agsrsegse agsrseegs agsrseesg agsrseseg agsrsesge agsersges agsersgse agsersegs
agsersesg agsersseg agserssge agsergses agsergsse agsergess agsergess agsergses agsergsse agseregss agseregss
agseresgs agseressg agseressg agseresgs agsersges agsersgse agsersegs agsersesg agsersseg agserssge agsesrges
agsesrgse agsesregs agsesresg agsesrseg agsesrsge agsesgres agsesgrse agsesgers agsesgesr agsesgser agsesgsre
agsesegrs agsesegsr agsesergs agsesersg agsesesrg agsesesgr agsessger agsessgre agsessegr agsesserg agsessreg
agsessrge agsegsres agsegsrse agsegsers agsegsesr agsegsser agsegssre agsegrses agsegrsse agsegress agsegress
agsegrses agsegrsse agsegerss agsegerss agsegesrs agsegessr agsegessr agsegesrs agsegsres agsegsrse agsegsers
agsegsesr agsegsser agsegssre agseesgrs agseesgsr agseesrgs agseesrsg agseessrg agseessgr agseegsrs agseegssr
agseegrss agseegrss agseegsrs agseegssr agseergss agseergss agseersgs agseerssg agseerssg agseersgs agseesgrs
agseesgsr agseesrgs agseesrsg agseessrg agseessgr agsessger agsessgre agsessegr agsesserg agsessreg agsessrge
agsesgser agsesgsre agsesgesr agsesgers agsesgres agsesgrse agsesegsr agsesegrs agsesesgr agsesesrg agsesersg
agsesergs agsesrges agsesrgse agsesregs agsesresg agsesrseg agsesrsge agsserges agssergse agsseregs agsseresg
agsserseg agssersge agssegres agssegrse agssegers agssegesr agssegser agssegsre agsseegrs agsseegsr agsseergs
agsseersg agsseesrg agsseesgr agssesger agssesgre agssesegr agsseserg agssesreg agssesrge agssreges agssregse
agssreegs agssreesg agssreseg agssresge agssrgees agssrgese agssrgees agssrgese agssrgsee agssrgsee agssreges
agssregse agssreegs agssreesg agssreseg agssresge agssrsgee agssrsgee agssrsege agssrseeg agssrseeg agssrsege
agssgrees agssgrese agssgrees agssgrese agssgrsee agssgrsee agssgeres agssgerse agssgeers agssgeesr agssgeser
agssgesre agssgeers agssgeesr agssgeres agssgerse agssgesre agssgeser agssgseer agssgsere agssgseer agssgsere
agssgsree agssgsree agsserges agssergse agsseregs agsseresg agsserseg agssersge agssegres agssegrse agssegers
agssegesr agssegser agssegsre agsseegrs agsseegsr agsseergs agsseersg agsseesrg agsseesgr agssesger agssesgre
agssesegr agsseserg agssesreg agssesrge agsssrgee agsssrgee agsssrege agsssreeg agsssreeg agsssrege agsssgree
agsssgree agsssgere agsssgeer agsssgeer agsssgere agsssegre agssseger agssserge agsssereg agssseerg agssseegr
agssseger agsssegre agssseegr agssseerg agsssereg agssserge agsgesres agsgesrse agsgesers agsgesesr agsgesser
agsgessre agsgerses agsgersse agsgeress agsgeress agsgerses agsgersse agsgeerss agsgeerss agsgeesrs agsgeessr
agsgeessr agsgeesrs agsgesres agsgesrse agsgesers agsgesesr agsgesser agsgessre agsgseres agsgserse agsgseers
agsgseesr agsgseser agsgsesre agsgsrees agsgsrese agsgsrees agsgsrese agsgsrsee agsgsrsee agsgseres agsgserse
agsgseers agsgseesr agsgseser agsgsesre agsgssree agsgssree agsgssere agsgsseer agsgsseer agsgssere agsgrsees
agsgrsese agsgrsees agsgrsese agsgrssee agsgrssee agsgreses agsgresse agsgreess agsgreess agsgreses agsgresse
agsgreess agsgreess agsgreses agsgresse agsgresse agsgreses agsgrsees agsgrsese agsgrsees agsgrsese agsgrssee
agsgrssee agsgesres agsgesrse agsgesers agsgesesr agsgesser agsgessre agsgerses agsgersse agsgeress agsgeress
agsgerses agsgersse agsgeerss agsgeerss agsgeesrs agsgeessr agsgeessr agsgeesrs agsgesres agsgesrse agsgesers
agsgesesr agsgesser agsgessre agsgssree agsgssree agsgssere agsgsseer agsgsseer agsgssere agsgsrsee agsgsrsee
agsgsrese agsgsrees agsgsrees agsgsrese agsgserse agsgseres agsgsesre agsgseser agsgseesr agsgseers agsgseres
agsgserse agsgseers agsgseesr agsgseser agsgsesre agseesgrs agseesgsr agseesrgs agseesrsg agseessrg agseessgr
agseegsrs agseegssr agseegrss agseegrss agseegsrs agseegssr agseergss agseergss agseersgs agseerssg agseerssg
agseersgs agseesgrs agseesgsr agseesrgs agseesrsg agseessrg agseessgr agsesegrs agsesegsr agsesergs agsesersg
agsesesrg agsesesgr agsesgers agsesgesr agsesgres agsesgrse agsesgsre agsesgser agsesrges agsesrgse agsesregs
agsesresg agsesrseg agsesrsge agsessgre agsessger agsessrge agsessreg agsesserg agsessegr agsegsers agsegsesr
agsegsres agsegsrse agsegssre agsegsser agsegesrs agsegessr agsegerss agsegerss agsegesrs agsegessr agsegress
agsegress agsegrses agsegrsse agsegrsse agsegrses agsegsers agsegsesr agsegsres agsegsrse agsegssre agsegsser
agsersges agsersgse agsersegs agsersesg agsersseg agserssge agsergses agsergsse agsergess agsergess agsergses
agsergsse agseregss agseregss agseresgs agseressg agseressg agseresgs agsersges agsersgse agsersegs agsersesg
agsersseg agserssge agsessgre agsessger agsessrge agsessreg agsesserg agsessegr agsesgsre agsesgser agsesgrse
agsesgres agsesgers agsesgesr agsesrgse agsesrges agsesrsge agsesrseg agsesresg agsesregs agsesegrs agsesegsr
agsesergs agsesersg agsesesrg agsesesgr agssesger agssesgre agssesegr agsseserg agssesreg agssesrge agssegser
agssegsre agssegesr agssegers agssegres agssegrse agsseegsr agsseegrs agsseesgr agsseesrg agsseersg agsseergs
agsserges agssergse agsseregs agsseresg agsserseg agssersge agssseger agsssegre agssseegr agssseerg agsssereg
agssserge agsssgeer agsssgere agsssgeer agsssgere agsssgree agsssgree agssseger agsssegre agssseegr agssseerg
agsssereg agssserge agsssrgee agsssrgee agsssrege agsssreeg agsssreeg agsssrege agssgseer agssgsere agssgseer
agssgsere agssgsree agssgsree agssgeser agssgesre agssgeesr agssgeers agssgeres agssgerse agssgeesr agssgeers
agssgeser agssgesre agssgerse agssgeres agssgrees agssgrese agssgrees agssgrese agssgrsee agssgrsee agssesger
agssesgre agssesegr agsseserg agssesreg agssesrge agssegser agssegsre agssegesr agssegers agssegres agssegrse
agsseegsr agsseegrs agsseesgr agsseesrg agsseersg agsseergs agsserges agssergse agsseregs agsseresg agsserseg
agssersge agssrsgee agssrsgee agssrsege agssrseeg agssrseeg agssrsege agssrgsee agssrgsee agssrgese agssrgees
agssrgees agssrgese agssregse agssreges agssresge agssreseg agssreesg agssreegs agssreges agssregse agssreegs
agssreesg agssreseg agssresge ageressgs ageresssg ageresgss ageresgss ageressgs ageresssg ageressgs ageresssg
ageresgss ageresgss ageressgs ageresssg ageregsss ageregsss ageregsss ageregsss ageregsss ageregsss ageressgs
ageresssg ageresgss ageresgss ageressgs ageresssg agersesgs agersessg agersegss agersegss agersesgs agersessg
agerssegs agerssesg agerssges agerssgse agersssge agerssseg agersgses agersgsse agersgess agersgess agersgses
agersgsse agersssge agerssseg agerssgse agerssges agerssegs agerssesg agerssegs agerssesg agerssges agerssgse
agersssge agerssseg agersesgs agersessg agersegss agersegss agersesgs agersessg agersgess agersgess agersgses
agersgsse agersgsse agersgses agerssegs agerssesg agerssges agerssgse agersssge agerssseg agergsses agergssse
agergsess agergsess agergsses agergssse agergsses agergssse agergsess agergsess agergsses agergssse agergesss
agergesss agergesss agergesss agergesss agergesss agergsses agergssse agergsess agergsess agergsses agergssse
agersssge agerssseg agerssgse agerssges agerssegs agerssesg agersssge agerssseg agerssgse agerssges agerssegs
agerssesg agersgsse agersgses agersgsse agersgses agersgess agersgess agersesgs agersessg agersegss agersegss
agersesgs agersessg ageerssgs ageersssg ageersgss ageersgss ageerssgs ageersssg ageerssgs ageersssg ageersgss
ageersgss ageerssgs ageersssg ageergsss ageergsss ageergsss ageergsss ageergsss ageergsss ageerssgs ageersssg
ageersgss ageersgss ageerssgs ageersssg ageesrsgs ageesrssg ageesrgss ageesrgss ageesrsgs ageesrssg ageessrgs
ageessrsg ageessgrs ageessgsr ageesssgr ageesssrg ageesgsrs ageesgssr ageesgrss ageesgrss ageesgsrs ageesgssr
ageesssgr ageesssrg ageessgsr ageessgrs ageessrgs ageessrsg ageessrgs ageessrsg ageessgrs ageessgsr ageesssgr
ageesssrg ageesrsgs ageesrssg ageesrgss ageesrgss ageesrsgs ageesrssg ageesgrss ageesgrss ageesgsrs ageesgssr
ageesgssr ageesgsrs ageessrgs ageessrsg ageessgrs ageessgsr ageesssgr ageesssrg ageegssrs ageegsssr ageegsrss
ageegsrss ageegssrs ageegsssr ageegssrs ageegsssr ageegsrss ageegsrss ageegssrs ageegsssr ageegrsss ageegrsss
ageegrsss ageegrsss ageegrsss ageegrsss ageegssrs ageegsssr ageegsrss ageegsrss ageegssrs ageegsssr ageesssgr
ageesssrg ageessgsr ageessgrs ageessrgs ageessrsg ageesssgr ageesssrg ageessgsr ageessgrs ageessrgs ageessrsg
ageesgssr ageesgsrs ageesgssr ageesgsrs ageesgrss ageesgrss ageesrsgs ageesrssg ageesrgss ageesrgss ageesrsgs
ageesrssg agesersgs ageserssg agesergss agesergss agesersgs ageserssg agesesrgs agesesrsg agesesgrs agesesgsr
agesessgr agesessrg agesegsrs agesegssr agesegrss agesegrss agesegsrs agesegssr agesessgr agesessrg agesesgsr
agesesgrs agesesrgs agesesrsg agesresgs agesressg agesregss agesregss agesresgs agesressg agesrsegs agesrsesg
agesrsges agesrsgse agesrssge agesrsseg agesrgses agesrgsse agesrgess agesrgess agesrgses agesrgsse agesrssge
agesrsseg agesrsgse agesrsges agesrsegs agesrsesg agessregs agessresg agessrges agessrgse agessrsge agessrseg
agessergs agessersg agessegrs agessegsr agessesgr agessesrg agessgers agessgesr agessgres agessgrse agessgsre
agessgser agesssegr agessserg agesssger agesssgre agesssrge agesssreg agesgrses agesgrsse agesgress agesgress
agesgrses agesgrsse agesgsres agesgsrse agesgsers agesgsesr agesgsser agesgssre agesgesrs agesgessr agesgerss
agesgerss agesgesrs agesgessr agesgsser agesgssre agesgsesr agesgsers agesgsres agesgsrse agessrsge agessrseg
agessrgse agessrges agessregs agessresg agesssrge agesssreg agesssgre agesssger agesssegr agessserg agessgsre
agessgser agessgrse agessgres agessgers agessgesr agessesgr agessesrg agessegsr agessegrs agessergs agessersg
agesesrgs agesesrsg agesesgrs agesesgsr agesessgr agesessrg agesersgs ageserssg agesergss agesergss agesersgs
ageserssg agesegrss agesegrss agesegsrs agesegssr agesegssr agesegsrs agesesrgs agesesrsg agesesgrs agesesgsr
agesessgr agesessrg agessergs agessersg agessegrs agessegsr agessesgr agessesrg agessregs agessresg agessrges
agessrgse agessrsge agessrseg agessgres agessgrse agessgers agessgesr agessgser agessgsre agesssrge agesssreg
agesssgre agesssger agesssegr agessserg agesrsegs agesrsesg agesrsges agesrsgse agesrssge agesrsseg agesresgs
agesressg agesregss agesregss agesresgs agesressg agesrgess agesrgess agesrgses agesrgsse agesrgsse agesrgses
agesrsegs agesrsesg agesrsges agesrsgse agesrssge agesrsseg agesgsres agesgsrse agesgsers agesgsesr agesgsser
agesgssre agesgrses agesgrsse agesgress agesgress agesgrses agesgrsse agesgerss agesgerss agesgesrs agesgessr
agesgessr agesgesrs agesgsres agesgsrse agesgsers agesgsesr agesgsser agesgssre agesssrge agesssreg agesssgre
agesssger agesssegr agessserg agessrsge agessrseg agessrgse agessrges agessregs agessresg agessgrse agessgres
agessgsre agessgser agessgesr agessgers agessergs agessersg agessegrs agessegsr agessesgr agessesrg agegessrs
agegesssr agegesrss agegesrss agegessrs agegesssr agegessrs agegesssr agegesrss agegesrss agegessrs agegesssr
agegersss agegersss agegersss agegersss agegersss agegersss agegessrs agegesssr agegesrss agegesrss agegessrs
agegesssr agegsesrs agegsessr agegserss agegserss agegsesrs agegsessr agegssers agegssesr agegssres agegssrse
agegsssre agegssser agegsrses agegsrsse agegsress agegsress agegsrses agegsrsse agegsssre agegssser agegssrse
agegssres agegssers agegssesr agegssers agegssesr agegssres agegssrse agegsssre agegssser agegsesrs agegsessr
agegserss agegserss agegsesrs agegsessr agegsress agegsress agegsrses agegsrsse agegsrsse agegsrses agegssers
agegssesr agegssres agegssrse agegsssre agegssser agegrsses agegrssse agegrsess agegrsess agegrsses agegrssse
agegrsses agegrssse agegrsess agegrsess agegrsses agegrssse agegresss agegresss agegresss agegresss agegresss
agegresss agegrsses agegrssse agegrsess agegrsess agegrsses agegrssse agegsssre agegssser agegssrse agegssres
agegssers agegssesr agegsssre agegssser agegssrse agegssres agegssers agegssesr agegsrsse agegsrses agegsrsse
agegsrses agegsress agegsress agegsesrs agegsessr agegserss agegserss agegsesrs agegsessr agesessgr agesessrg
agesesgsr agesesgrs agesesrgs agesesrsg agesessgr agesessrg agesesgsr agesesgrs agesesrgs agesesrsg agesegssr
agesegsrs agesegssr agesegsrs agesegrss agesegrss agesersgs ageserssg agesergss agesergss agesersgs ageserssg
agessesgr agessesrg agessegsr agessegrs agessergs agessersg agesssegr agessserg agesssger agesssgre agesssrge
agesssreg agessgser agessgsre agessgesr agessgers agessgres agessgrse agessrsge agessrseg agessrgse agessrges
agessregs agessresg agesssegr agessserg agesssger agesssgre agesssrge agesssreg agessesgr agessesrg agessegsr
agessegrs agessergs agessersg agessgesr agessgers agessgser agessgsre agessgrse agessgres agessregs agessresg
agessrges agessrgse agessrsge agessrseg agesgsser agesgssre agesgsesr agesgsers agesgsres agesgsrse agesgsser
agesgssre agesgsesr agesgsers agesgsres agesgsrse agesgessr agesgesrs agesgessr agesgesrs agesgerss agesgerss
agesgrses agesgrsse agesgress agesgress agesgrses agesgrsse agesrssge agesrsseg agesrsgse agesrsges agesrsegs
agesrsesg agesrssge agesrsseg agesrsgse agesrsges agesrsegs agesrsesg agesrgsse agesrgses agesrgsse agesrgses
agesrgess agesrgess agesresgs agesressg agesregss agesregss agesresgs agesressg agsresseg agsressge agsresesg
agsresegs agsresges agsresgse agsresseg agsressge agsresesg agsresegs agsresges agsresgse agsreessg agsreesgs
agsreessg agsreesgs agsreegss agsreegss agsregses agsregsse agsregess agsregess agsregses agsregsse agsrseseg
agsrsesge agsrseesg agsrseegs agsrseges agsrsegse agsrsseeg agsrssege agsrsseeg agsrssege agsrssgee agsrssgee
agsrseseg agsrsesge agsrseesg agsrseegs agsrseges agsrsegse agsrsgsee agsrsgsee agsrsgese agsrsgees agsrsgees
agsrsgese agsrsseeg agsrssege agsrsseeg agsrssege agsrssgee agsrssgee agsrseseg agsrsesge agsrseesg agsrseegs
agsrseges agsrsegse agsrseesg agsrseegs agsrseseg agsrsesge agsrsegse agsrseges agsrsgees agsrsgese agsrsgees
agsrsgese agsrsgsee agsrsgsee agsresseg agsressge agsresesg agsresegs agsresges agsresgse agsresseg agsressge
agsresesg agsresegs agsresges agsresgse agsreessg agsreesgs agsreessg agsreesgs agsreegss agsreegss agsregses
agsregsse agsregess agsregess agsregses agsregsse agsrgssee agsrgssee agsrgsese agsrgsees agsrgsees agsrgsese
agsrgssee agsrgssee agsrgsese agsrgsees agsrgsees agsrgsese agsrgesse agsrgeses agsrgesse agsrgeses agsrgeess
agsrgeess agsrgeses agsrgesse agsrgeess agsrgeess agsrgeses agsrgesse agsersseg agserssge agsersesg agsersegs
agsersges agsersgse agsersseg agserssge agsersesg agsersegs agsersges agsersgse agseressg agseresgs agseressg
agseresgs agseregss agseregss agsergses agsergsse agsergess agsergess agsergses agsergsse agsesrseg agsesrsge
agsesresg agsesregs agsesrges agsesrgse agsessreg agsessrge agsesserg agsessegr agsessger agsessgre agsesesrg
agsesesgr agsesersg agsesergs agsesegrs agsesegsr agsesgser agsesgsre agsesgesr agsesgers agsesgres agsesgrse
agsessreg agsessrge agsesserg agsessegr agsessger agsessgre agsesrseg agsesrsge agsesresg agsesregs agsesrges
agsesrgse agsesersg agsesergs agsesesrg agsesesgr agsesegsr agsesegrs agsesgres agsesgrse agsesgers agsesgesr
agsesgser agsesgsre agseessrg agseessgr agseesrsg agseesrgs agseesgrs agseesgsr agseessrg agseessgr agseesrsg
agseesrgs agseesgrs agseesgsr agseerssg agseersgs agseerssg agseersgs agseergss agseergss agseegsrs agseegssr
agseegrss agseegrss agseegsrs agseegssr agsegsser agsegssre agsegsesr agsegsers agsegsres agsegsrse agsegsser
agsegssre agsegsesr agsegsers agsegsres agsegsrse agsegessr agsegesrs agsegessr agsegesrs agsegerss agsegerss
agsegrses agsegrsse agsegress agsegress agsegrses agsegrsse agsserseg agssersge agsseresg agsseregs agsserges
agssergse agssesreg agssesrge agsseserg agssesegr agssesger agssesgre agsseesrg agsseesgr agsseersg agsseergs
agsseegrs agsseegsr agssegser agssegsre agssegesr agssegers agssegres agssegrse agssreseg agssresge agssreesg
agssreegs agssreges agssregse agssrseeg agssrsege agssrseeg agssrsege agssrsgee agssrsgee agssreseg agssresge
agssreesg agssreegs agssreges agssregse agssrgsee agssrgsee agssrgese agssrgees agssrgees agssrgese agsssreeg
agsssrege agsssreeg agsssrege agsssrgee agsssrgee agsssereg agssserge agssseerg agssseegr agssseger agsssegre
agssseerg agssseegr agsssereg agssserge agsssegre agssseger agsssgeer agsssgere agsssgeer agsssgere agsssgree
agsssgree agsserseg agssersge agsseresg agsseregs agsserges agssergse agssesreg agssesrge agsseserg agssesegr
agssesger agssesgre agsseesrg agsseesgr agsseersg agsseergs agsseegrs agsseegsr agssegser agssegsre agssegesr
agssegers agssegres agssegrse agssgrsee agssgrsee agssgrese agssgrees agssgrees agssgrese agssgsree agssgsree
agssgsere agssgseer agssgseer agssgsere agssgesre agssgeser agssgerse agssgeres agssgeers agssgeesr agssgeser
agssgesre agssgeesr agssgeers agssgeres agssgerse agssesreg agssesrge agsseserg agssesegr agssesger agssesgre
agsserseg agssersge agsseresg agsseregs agsserges agssergse agsseersg agsseergs agsseesrg agsseesgr agsseegsr
agsseegrs agssegres agssegrse agssegers agssegesr agssegser agssegsre agsssereg agssserge agssseerg agssseegr
agssseger agsssegre agsssreeg agsssrege agsssreeg agsssrege agsssrgee agsssrgee agsssereg agssserge agssseerg
agssseegr agssseger agsssegre agsssgree agsssgree agsssgere agsssgeer agsssgeer agsssgere agssrseeg agssrsege
agssrseeg agssrsege agssrsgee agssrsgee agssreseg agssresge agssreesg agssreegs agssreges agssregse agssreesg
agssreegs agssreseg agssresge agssregse agssreges agssrgees agssrgese agssrgees agssrgese agssrgsee agssrgsee
agssesreg agssesrge agsseserg agssesegr agssesger agssesgre agsserseg agssersge agsseresg agsseregs agsserges
agssergse agsseersg agsseergs agsseesrg agsseesgr agsseegsr agsseegrs agssegres agssegrse agssegers agssegesr
agssegser agssegsre agssgsree agssgsree agssgsere agssgseer agssgseer agssgsere agssgrsee agssgrsee agssgrese
agssgrees agssgrees agssgrese agssgerse agssgeres agssgesre agssgeser agssgeesr agssgeers agssgeres agssgerse
agssgeers agssgeesr agssgeser agssgesre agseessrg agseessgr agseesrsg agseesrgs agseesgrs agseesgsr agseessrg
agseessgr agseesrsg agseesrgs agseesgrs agseesgsr agseerssg agseersgs agseerssg agseersgs agseergss agseergss
agseegsrs agseegssr agseegrss agseegrss agseegsrs agseegssr agsesesrg agsesesgr agsesersg agsesergs agsesegrs
agsesegsr agsesserg agsessegr agsessreg agsessrge agsessgre agsessger agsesrseg agsesrsge agsesresg agsesregs
agsesrges agsesrgse agsesgsre agsesgser agsesgrse agsesgres agsesgers agsesgesr agsesserg agsessegr agsessreg
agsessrge agsessgre agsessger agsesesrg agsesesgr agsesersg agsesergs agsesegrs agsesegsr agsesresg agsesregs
agsesrseg agsesrsge agsesrgse agsesrges agsesgers agsesgesr agsesgres agsesgrse agsesgsre agsesgser agsersseg
agserssge agsersesg agsersegs agsersges agsersgse agsersseg agserssge agsersesg agsersegs agsersges agsersgse
agseressg agseresgs agseressg agseresgs agseregss agseregss agsergses agsergsse agsergess agsergess agsergses
agsergsse agsegssre agsegsser agsegsrse agsegsres agsegsers agsegsesr agsegssre agsegsser agsegsrse agsegsres
agsegsers agsegsesr agsegrsse agsegrses agsegrsse agsegrses agsegress agsegress agsegesrs agsegessr agsegerss
agsegerss agsegesrs agsegessr agsgesser agsgessre agsgesesr agsgesers agsgesres agsgesrse agsgesser agsgessre
agsgesesr agsgesers agsgesres agsgesrse agsgeessr agsgeesrs agsgeessr agsgeesrs agsgeerss agsgeerss agsgerses
agsgersse agsgeress agsgeress agsgerses agsgersse agsgseser agsgsesre agsgseesr agsgseers agsgseres agsgserse
agsgsseer agsgssere agsgsseer agsgssere agsgssree agsgssree agsgseser agsgsesre agsgseesr agsgseers agsgseres
agsgserse agsgsrsee agsgsrsee agsgsrese agsgsrees agsgsrees agsgsrese agsgsseer agsgssere agsgsseer agsgssere
agsgssree agsgssree agsgseser agsgsesre agsgseesr agsgseers agsgseres agsgserse agsgseesr agsgseers agsgseser
agsgsesre agsgserse agsgseres agsgsrees agsgsrese agsgsrees agsgsrese agsgsrsee agsgsrsee agsgesser agsgessre
agsgesesr agsgesers agsgesres agsgesrse agsgesser agsgessre agsgesesr agsgesers agsgesres agsgesrse agsgeessr
agsgeesrs agsgeessr agsgeesrs agsgeerss agsgeerss agsgerses agsgersse agsgeress agsgeress agsgerses agsgersse
agsgrssee agsgrssee agsgrsese agsgrsees agsgrsees agsgrsese agsgrssee agsgrssee agsgrsese agsgrsees agsgrsees
agsgrsese agsgresse agsgreses agsgresse agsgreses agsgreess agsgreess agsgreses agsgresse agsgreess agsgreess
agsgreses agsgresse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us