easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

tumbled

tuite

tinderous

trunmpet

aeciostage

ventricornu

venipuncture

auxograph

unsurpassably

mrugesh

wangala

distensive

duryodhana

zerlina

sistrums

stimulations

cerithioid

weeding


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: abortusbovis
cipher variations:
bcpsuvtcpwjt cdqtvwudqxku deruwxverylv efsvxywfszmw fgtwyzxgtanx
ghuxzayhuboy hivyabzivcpz ijwzbcajwdqa jkxacdbkxerb klybdeclyfsc
lmzcefdmzgtd mnadfgenahue nobeghfobivf opcfhigpcjwg pqdgijhqdkxh
qrehjkirelyi rsfikljsfmzj stgjlmktgnak tuhkmnluhobl uvilnomvipcm
vwjmopnwjqdn wxknpqoxkreo xyloqrpylsfp yzmprsqzmtgq zanqstranuhr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: abortusbovis
Cipher: zyligfhylerh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: abortusbovis
Cipher: AAAAA AAAAB ABBAB BAAAA BAABA BAABB BAAAB AAAAB ABBAB BBBAB ABAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: abortusbovis
cipher variations:
bcpsuvtcpwjtberagjdermzdbgtisxngtcpnbivqelxivsfxbkxyqzhkxivhbmzgcnrmzylrbqdwaplqderlbsfemdvsfuhv
buhmyrfuhkxfbwjukfpwjanpbylcwtzylqdzbankihjangtjcdqtvwudqxkucfsbhkefsnaechujtyohudqocjwrfmyjwtgy
clyzrailyjwicnahdosnazmscrexbqmrefsmctgfnewtgviwcvinzsgvilygcxkvlgqxkboqczmdxuazmreacboljikbohuk
deruwxverylvdgtcilfgtobfdivkuzpiverpdkxsgnzkxuhzdmzasbjmzkxjdobieptobantdsfycrnsfgtnduhgofxuhwjx
dwjoathwjmzhdylwmhrylcprdaneyvbansfbdcpmkjlcpivlefsvxywfszmwehudjmghupcgejwlvaqjwfsqelythoalyvia
enabtcknalykepcjfqupcbouetgzdsotghuoevihpgyvixkyexkpbuixknaiezmxniszmdqsebofzwcbotgcedqnlkmdqjwm
fgtwyzxgtanxfiveknhivqdhfkxmwbrkxgtrfmzuipbmzwjbfobcudlobmzlfqdkgrvqdcpvfuhaetpuhivpfwjiqhzwjylz
fylqcvjylobjfanyojtanertfcpgaxdcpuhdferomlnerkxnghuxzayhuboygjwfloijwreiglynxcslyhusgnavjqcnaxkc
gpcdvempcnamgrelhswredqwgvibfuqvijwqgxkjriaxkzmagzmrdwkzmpckgbozpkubofsugdqhbyedqviegfspnmofslyo
hivyabzivcpzhkxgmpjkxsfjhmzoydtmzivthobwkrdobyldhqdewfnqdobnhsfmitxsferxhwjcgvrwjkxrhylksjbylanb
hansexlanqdlhcpaqlvcpgtvhericzferwjfhgtqonpgtmzpijwzbcajwdqailyhnqklytgkinapzeunajwuipcxlsepczme
irefxgorepcoitgnjuytgfsyixkdhwsxklysizmltkczmbocibotfymboremidqbrmwdqhuwifsjdagfsxkgihurpoqhunaq
jkxacdbkxerbjmziorlmzuhljobqafvobkxvjqdymtfqdanfjsfgyhpsfqdpjuhokvzuhgtzjyleixtylmztjanmuldancpd
jcpugzncpsfnjercsnxerivxjgtkebhgtylhjivsqprivobrklybdeclyfscknajpsmnavimkpcrbgwpclywkreznugrebog
ktghziqtgreqkviplwavihuakzmfjyuzmnaukbonvmebodqekdqvhaodqtgokfsdtoyfsjwykhulfcihuzmikjwtrqsjwpcs
lmzcefdmzgtdlobkqtnobwjnlqdschxqdmzxlsfaovhsfcphluhiajruhsfrlwjqmxbwjivblangkzvanobvlcpownfcperf
lerwibperuhplgteupzgtkxzlivmgdjivanjlkxusrtkxqdtmnadfgenahuempclruopcxkomretdiyrenaymtgbpwitgdqi
mvijbksvitgsmxkrnycxkjwcmbohlawbopcwmdqpxogdqfsgmfsxjcqfsviqmhufvqahulyamjwnhekjwbokmlyvtsulyreu
nobeghfobivfnqdmsvpqdylpnsfuejzsfobznuhcqxjuherjnwjkcltwjuhtnylsozdylkxdncpimbxcpqdxnerqyphergth
ngtykdrgtwjrnivgwrbivmzbnkxoiflkxcplnmzwutvmzsfvopcfhigpcjwgorentwqrezmqotgvfkatgpcaovidrykvifsk
oxkldmuxkviuozmtpaezmlyeodqjncydqreyofsrzqifshuiohuzleshuxksojwhxscjwnacolypjgmlydqmonaxvuwnatgw
pqdgijhqdkxhpsfouxrsfanrpuhwglbuhqdbpwjeszlwjgtlpylmenvylwjvpanuqbfanmzfperkodzersfzpgtsarjgtivj
pivamftivyltpkxiytdkxobdpmzqkhnmzernpobywvxobuhxqrehjkirelyiqtgpvystgbosqvixhmcvirecqxkftamxkhum
qzmnfowzmxkwqbovrcgbonagqfslpeafstgaqhutbskhujwkqjwbngujwzmuqlyjzuelypceqnarlionafsoqpczxwypcviy
rsfikljsfmzjruhqwztuhcptrwjyindwjsfdrylgubnylivnranogpxanylxrcpwsdhcpobhrgtmqfbgtuhbrivuctlivkxl
rkxcohvkxanvrmzkavfmzqdfrobsmjpobgtprqdayxzqdwjzstgjlmktgnaksvirxauvidqusxkzjoexktgeszmhvcozmjwo
sbophqybozmysdqxteidqpcishunrgchuvicsjwvdumjwlymslydpiwlybowsnalbwgnaregspctnkqpchuqsrebzyarexka
tuhkmnluhobltwjsybvwjervtylakpfyluhftaniwdpankxptcpqirzcpanzteryufjerqdjtivoshdivwjdtkxwevnkxmzn
tmzeqjxmzcpxtobmcxhobsfhtqduolrqdivrtsfcazbsfylbuvilnomvipcmuxktzcwxkfswuzmblqgzmvigubojxeqbolyq
udqrjsadqboaufszvgkfsrekujwptiejwxkeulyxfwolynaounafrkynadqyupcndyipctgiurevpmsrejwsutgdbactgzmc
vwjmopnwjqdnvyluadxylgtxvancmrhanwjhvcpkyfrcpmzrversktbercpbvgtawhlgtsflvkxqujfkxylfvmzygxpmzobp
vobgslzoberzvqdoezjqduhjvsfwqntsfkxtvuhecbduhandwxknpqoxkreowzmvbeyzmhuywbodnsiboxkiwdqlzgsdqnas
wfstlucfsdqcwhubximhutgmwlyrvkglyzmgwnazhyqnapcqwpchtmapcfsawrepfakrevikwtgxroutglyuwvifdceviboe
xyloqrpylsfpxanwcfzanivzxcpeotjcpyljxermahterobtxgtumvdgterdxivcyjnivuhnxmzswlhmzanhxobaizrobqdr
xqdiunbqdgtbxsfqgblsfwjlxuhyspvuhmzvxwjgedfwjcpfyzmprsqzmtgqyboxdgabojwaydqfpukdqzmkyfsnbiufspcu
yhuvnwehufseyjwdzkojwvioynatxminaboiypcbjaspcresyrejvocrehucytgrhcmtgxkmyviztqwvinawyxkhfegxkdqg
zanqstranuhrzcpyehbcpkxbzergqvleranlzgtocjvgtqdvzivwoxfivgtfzkxealpkxwjpzobuynjobcpjzqdckbtqdsft
zsfkwpdsfivdzuhsidnuhylnzwjaurxwjobxzyligfhylerhabortusbovisadqzficdqlycafshrwmfsbomahupdkwhurew
ajwxpygjwhugalyfbmqlyxkqapcvzokpcdqkaredlcuretguatglxqetgjweavitjeovizmoaxkbvsyxkpcyazmjhgizmfsi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: abortusbovis
Cipher: nobeghfobivf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: abortusbovis
Cipher: 112143244454342143154234

Extended Methods:
Method #1

Plaintext: abortusbovis
method variations:
fgtwyzxgtaoxlmybdecmyftcqrdgikhrdlyhvwimopnwiqdn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a b o r t u s b o v i s 
1 2 4 2 4 5 3 2 4 1 4 3 
1 1 3 4 4 4 4 1 3 5 2 4 
They are then read out in rows:
124245324143113444413524
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: abortusbovis
Cipher: fiyhdoastdxr

Read more ...
Method #3

Plaintext: abortusbovis
method variations:
fqhtyoiqcumd qhtyoiqcumdf htyoiqcumdfq
tyoiqcumdfqh yoiqcumdfqht oiqcumdfqhty
iqcumdfqhtyo qcumdfqhtyoi cumdfqhtyoiq
umdfqhtyoiqc mdfqhtyoiqcu dfqhtyoiqcum

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: abortusbovis

first 5040 cipher variations(475687488 total)
abortusbovis abortusbovsi abortusboivs abortusboisv abortusbosiv abortusbosvi abortusbvois abortusbvosi abortusbvios
abortusbviso abortusbvsio abortusbvsoi abortusbivos abortusbivso abortusbiovs abortusbiosv abortusbisov abortusbisvo
abortusbsvio abortusbsvoi abortusbsivo abortusbsiov abortusbsoiv abortusbsovi abortusobvis abortusobvsi abortusobivs
abortusobisv abortusobsiv abortusobsvi abortusovbis abortusovbsi abortusovibs abortusovisb abortusovsib abortusovsbi
abortusoivbs abortusoivsb abortusoibvs abortusoibsv abortusoisbv abortusoisvb abortusosvib abortusosvbi abortusosivb
abortusosibv abortusosbiv abortusosbvi abortusvobis abortusvobsi abortusvoibs abortusvoisb abortusvosib abortusvosbi
abortusvbois abortusvbosi abortusvbios abortusvbiso abortusvbsio abortusvbsoi abortusvibos abortusvibso abortusviobs
abortusviosb abortusvisob abortusvisbo abortusvsbio abortusvsboi abortusvsibo abortusvsiob abortusvsoib abortusvsobi
abortusiovbs abortusiovsb abortusiobvs abortusiobsv abortusiosbv abortusiosvb abortusivobs abortusivosb abortusivbos
abortusivbso abortusivsbo abortusivsob abortusibvos abortusibvso abortusibovs abortusibosv abortusibsov abortusibsvo
abortusisvbo abortusisvob abortusisbvo abortusisbov abortusisobv abortusisovb abortussovib abortussovbi abortussoivb
abortussoibv abortussobiv abortussobvi abortussvoib abortussvobi abortussviob abortussvibo abortussvbio abortussvboi
abortussivob abortussivbo abortussiovb abortussiobv abortussibov abortussibvo abortussbvio abortussbvoi abortussbivo
abortussbiov abortussboiv abortussbovi abortubsovis abortubsovsi abortubsoivs abortubsoisv abortubsosiv abortubsosvi
abortubsvois abortubsvosi abortubsvios abortubsviso abortubsvsio abortubsvsoi abortubsivos abortubsivso abortubsiovs
abortubsiosv abortubsisov abortubsisvo abortubssvio abortubssvoi abortubssivo abortubssiov abortubssoiv abortubssovi
abortubosvis abortubosvsi abortubosivs abortubosisv abortubossiv abortubossvi abortubovsis abortubovssi abortuboviss
abortuboviss abortubovsis abortubovssi abortuboivss abortuboivss abortuboisvs abortuboissv abortuboissv abortuboisvs
abortubosvis abortubosvsi abortubosivs abortubosisv abortubossiv abortubossvi abortubvosis abortubvossi abortubvoiss
abortubvoiss abortubvosis abortubvossi abortubvsois abortubvsosi abortubvsios abortubvsiso abortubvssio abortubvssoi
abortubvisos abortubvisso abortubvioss abortubvioss abortubvisos abortubvisso abortubvssio abortubvssoi abortubvsiso
abortubvsios abortubvsois abortubvsosi abortubiovss abortubiovss abortubiosvs abortubiossv abortubiossv abortubiosvs
abortubivoss abortubivoss abortubivsos abortubivsso abortubivsso abortubivsos abortubisvos abortubisvso abortubisovs
abortubisosv abortubissov abortubissvo abortubisvso abortubisvos abortubissvo abortubissov abortubisosv abortubisovs
abortubsovis abortubsovsi abortubsoivs abortubsoisv abortubsosiv abortubsosvi abortubsvois abortubsvosi abortubsvios
abortubsviso abortubsvsio abortubsvsoi abortubsivos abortubsivso abortubsiovs abortubsiosv abortubsisov abortubsisvo
abortubssvio abortubssvoi abortubssivo abortubssiov abortubssoiv abortubssovi abortuobsvis abortuobsvsi abortuobsivs
abortuobsisv abortuobssiv abortuobssvi abortuobvsis abortuobvssi abortuobviss abortuobviss abortuobvsis abortuobvssi
abortuobivss abortuobivss abortuobisvs abortuobissv abortuobissv abortuobisvs abortuobsvis abortuobsvsi abortuobsivs
abortuobsisv abortuobssiv abortuobssvi abortuosbvis abortuosbvsi abortuosbivs abortuosbisv abortuosbsiv abortuosbsvi
abortuosvbis abortuosvbsi abortuosvibs abortuosvisb abortuosvsib abortuosvsbi abortuosivbs abortuosivsb abortuosibvs
abortuosibsv abortuosisbv abortuosisvb abortuossvib abortuossvbi abortuossivb abortuossibv abortuossbiv abortuossbvi
abortuovsbis abortuovsbsi abortuovsibs abortuovsisb abortuovssib abortuovssbi abortuovbsis abortuovbssi abortuovbiss
abortuovbiss abortuovbsis abortuovbssi abortuovibss abortuovibss abortuovisbs abortuovissb abortuovissb abortuovisbs
abortuovsbis abortuovsbsi abortuovsibs abortuovsisb abortuovssib abortuovssbi abortuoisvbs abortuoisvsb abortuoisbvs
abortuoisbsv abortuoissbv abortuoissvb abortuoivsbs abortuoivssb abortuoivbss abortuoivbss abortuoivsbs abortuoivssb
abortuoibvss abortuoibvss abortuoibsvs abortuoibssv abortuoibssv abortuoibsvs abortuoisvbs abortuoisvsb abortuoisbvs
abortuoisbsv abortuoissbv abortuoissvb abortuossvib abortuossvbi abortuossivb abortuossibv abortuossbiv abortuossbvi
abortuosvsib abortuosvsbi abortuosvisb abortuosvibs abortuosvbis abortuosvbsi abortuosivsb abortuosivbs abortuosisvb
abortuosisbv abortuosibsv abortuosibvs abortuosbvis abortuosbvsi abortuosbivs abortuosbisv abortuosbsiv abortuosbsvi
abortuvbosis abortuvbossi abortuvboiss abortuvboiss abortuvbosis abortuvbossi abortuvbsois abortuvbsosi abortuvbsios
abortuvbsiso abortuvbssio abortuvbssoi abortuvbisos abortuvbisso abortuvbioss abortuvbioss abortuvbisos abortuvbisso
abortuvbssio abortuvbssoi abortuvbsiso abortuvbsios abortuvbsois abortuvbsosi abortuvobsis abortuvobssi abortuvobiss
abortuvobiss abortuvobsis abortuvobssi abortuvosbis abortuvosbsi abortuvosibs abortuvosisb abortuvossib abortuvossbi
abortuvoisbs abortuvoissb abortuvoibss abortuvoibss abortuvoisbs abortuvoissb abortuvossib abortuvossbi abortuvosisb
abortuvosibs abortuvosbis abortuvosbsi abortuvsobis abortuvsobsi abortuvsoibs abortuvsoisb abortuvsosib abortuvsosbi
abortuvsbois abortuvsbosi abortuvsbios abortuvsbiso abortuvsbsio abortuvsbsoi abortuvsibos abortuvsibso abortuvsiobs
abortuvsiosb abortuvsisob abortuvsisbo abortuvssbio abortuvssboi abortuvssibo abortuvssiob abortuvssoib abortuvssobi
abortuviosbs abortuviossb abortuviobss abortuviobss abortuviosbs abortuviossb abortuvisobs abortuvisosb abortuvisbos
abortuvisbso abortuvissbo abortuvissob abortuvibsos abortuvibsso abortuviboss abortuviboss abortuvibsos abortuvibsso
abortuvissbo abortuvissob abortuvisbso abortuvisbos abortuvisobs abortuvisosb abortuvsosib abortuvsosbi abortuvsoisb
abortuvsoibs abortuvsobis abortuvsobsi abortuvssoib abortuvssobi abortuvssiob abortuvssibo abortuvssbio abortuvssboi
abortuvsisob abortuvsisbo abortuvsiosb abortuvsiobs abortuvsibos abortuvsibso abortuvsbsio abortuvsbsoi abortuvsbiso
abortuvsbios abortuvsbois abortuvsbosi abortuibovss abortuibovss abortuibosvs abortuibossv abortuibossv abortuibosvs
abortuibvoss abortuibvoss abortuibvsos abortuibvsso abortuibvsso abortuibvsos abortuibsvos abortuibsvso abortuibsovs
abortuibsosv abortuibssov abortuibssvo abortuibsvso abortuibsvos abortuibssvo abortuibssov abortuibsosv abortuibsovs
abortuiobvss abortuiobvss abortuiobsvs abortuiobssv abortuiobssv abortuiobsvs abortuiovbss abortuiovbss abortuiovsbs
abortuiovssb abortuiovssb abortuiovsbs abortuiosvbs abortuiosvsb abortuiosbvs abortuiosbsv abortuiossbv abortuiossvb
abortuiosvsb abortuiosvbs abortuiossvb abortuiossbv abortuiosbsv abortuiosbvs abortuivobss abortuivobss abortuivosbs
abortuivossb abortuivossb abortuivosbs abortuivboss abortuivboss abortuivbsos abortuivbsso abortuivbsso abortuivbsos
abortuivsbos abortuivsbso abortuivsobs abortuivsosb abortuivssob abortuivssbo abortuivsbso abortuivsbos abortuivssbo
abortuivssob abortuivsosb abortuivsobs abortuisovbs abortuisovsb abortuisobvs abortuisobsv abortuisosbv abortuisosvb
abortuisvobs abortuisvosb abortuisvbos abortuisvbso abortuisvsbo abortuisvsob abortuisbvos abortuisbvso abortuisbovs
abortuisbosv abortuisbsov abortuisbsvo abortuissvbo abortuissvob abortuissbvo abortuissbov abortuissobv abortuissovb
abortuisovsb abortuisovbs abortuisosvb abortuisosbv abortuisobsv abortuisobvs abortuisvosb abortuisvobs abortuisvsob
abortuisvsbo abortuisvbso abortuisvbos abortuissvob abortuissvbo abortuissovb abortuissobv abortuissbov abortuissbvo
abortuisbvso abortuisbvos abortuisbsvo abortuisbsov abortuisbosv abortuisbovs abortusbovis abortusbovsi abortusboivs
abortusboisv abortusbosiv abortusbosvi abortusbvois abortusbvosi abortusbvios abortusbviso abortusbvsio abortusbvsoi
abortusbivos abortusbivso abortusbiovs abortusbiosv abortusbisov abortusbisvo abortusbsvio abortusbsvoi abortusbsivo
abortusbsiov abortusbsoiv abortusbsovi abortusobvis abortusobvsi abortusobivs abortusobisv abortusobsiv abortusobsvi
abortusovbis abortusovbsi abortusovibs abortusovisb abortusovsib abortusovsbi abortusoivbs abortusoivsb abortusoibvs
abortusoibsv abortusoisbv abortusoisvb abortusosvib abortusosvbi abortusosivb abortusosibv abortusosbiv abortusosbvi
abortusvobis abortusvobsi abortusvoibs abortusvoisb abortusvosib abortusvosbi abortusvbois abortusvbosi abortusvbios
abortusvbiso abortusvbsio abortusvbsoi abortusvibos abortusvibso abortusviobs abortusviosb abortusvisob abortusvisbo
abortusvsbio abortusvsboi abortusvsibo abortusvsiob abortusvsoib abortusvsobi abortusiovbs abortusiovsb abortusiobvs
abortusiobsv abortusiosbv abortusiosvb abortusivobs abortusivosb abortusivbos abortusivbso abortusivsbo abortusivsob
abortusibvos abortusibvso abortusibovs abortusibosv abortusibsov abortusibsvo abortusisvbo abortusisvob abortusisbvo
abortusisbov abortusisobv abortusisovb abortussovib abortussovbi abortussoivb abortussoibv abortussobiv abortussobvi
abortussvoib abortussvobi abortussviob abortussvibo abortussvbio abortussvboi abortussivob abortussivbo abortussiovb
abortussiobv abortussibov abortussibvo abortussbvio abortussbvoi abortussbivo abortussbiov abortussboiv abortussbovi
abortsubovis abortsubovsi abortsuboivs abortsuboisv abortsubosiv abortsubosvi abortsubvois abortsubvosi abortsubvios
abortsubviso abortsubvsio abortsubvsoi abortsubivos abortsubivso abortsubiovs abortsubiosv abortsubisov abortsubisvo
abortsubsvio abortsubsvoi abortsubsivo abortsubsiov abortsubsoiv abortsubsovi abortsuobvis abortsuobvsi abortsuobivs
abortsuobisv abortsuobsiv abortsuobsvi abortsuovbis abortsuovbsi abortsuovibs abortsuovisb abortsuovsib abortsuovsbi
abortsuoivbs abortsuoivsb abortsuoibvs abortsuoibsv abortsuoisbv abortsuoisvb abortsuosvib abortsuosvbi abortsuosivb
abortsuosibv abortsuosbiv abortsuosbvi abortsuvobis abortsuvobsi abortsuvoibs abortsuvoisb abortsuvosib abortsuvosbi
abortsuvbois abortsuvbosi abortsuvbios abortsuvbiso abortsuvbsio abortsuvbsoi abortsuvibos abortsuvibso abortsuviobs
abortsuviosb abortsuvisob abortsuvisbo abortsuvsbio abortsuvsboi abortsuvsibo abortsuvsiob abortsuvsoib abortsuvsobi
abortsuiovbs abortsuiovsb abortsuiobvs abortsuiobsv abortsuiosbv abortsuiosvb abortsuivobs abortsuivosb abortsuivbos
abortsuivbso abortsuivsbo abortsuivsob abortsuibvos abortsuibvso abortsuibovs abortsuibosv abortsuibsov abortsuibsvo
abortsuisvbo abortsuisvob abortsuisbvo abortsuisbov abortsuisobv abortsuisovb abortsusovib abortsusovbi abortsusoivb
abortsusoibv abortsusobiv abortsusobvi abortsusvoib abortsusvobi abortsusviob abortsusvibo abortsusvbio abortsusvboi
abortsusivob abortsusivbo abortsusiovb abortsusiobv abortsusibov abortsusibvo abortsusbvio abortsusbvoi abortsusbivo
abortsusbiov abortsusboiv abortsusbovi abortsbuovis abortsbuovsi abortsbuoivs abortsbuoisv abortsbuosiv abortsbuosvi
abortsbuvois abortsbuvosi abortsbuvios abortsbuviso abortsbuvsio abortsbuvsoi abortsbuivos abortsbuivso abortsbuiovs
abortsbuiosv abortsbuisov abortsbuisvo abortsbusvio abortsbusvoi abortsbusivo abortsbusiov abortsbusoiv abortsbusovi
abortsbouvis abortsbouvsi abortsbouivs abortsbouisv abortsbousiv abortsbousvi abortsbovuis abortsbovusi abortsbovius
abortsbovisu abortsbovsiu abortsbovsui abortsboivus abortsboivsu abortsboiuvs abortsboiusv abortsboisuv abortsboisvu
abortsbosviu abortsbosvui abortsbosivu abortsbosiuv abortsbosuiv abortsbosuvi abortsbvouis abortsbvousi abortsbvoius
abortsbvoisu abortsbvosiu abortsbvosui abortsbvuois abortsbvuosi abortsbvuios abortsbvuiso abortsbvusio abortsbvusoi
abortsbviuos abortsbviuso abortsbvious abortsbviosu abortsbvisou abortsbvisuo abortsbvsuio abortsbvsuoi abortsbvsiuo
abortsbvsiou abortsbvsoiu abortsbvsoui abortsbiovus abortsbiovsu abortsbiouvs abortsbiousv abortsbiosuv abortsbiosvu
abortsbivous abortsbivosu abortsbivuos abortsbivuso abortsbivsuo abortsbivsou abortsbiuvos abortsbiuvso abortsbiuovs
abortsbiuosv abortsbiusov abortsbiusvo abortsbisvuo abortsbisvou abortsbisuvo abortsbisuov abortsbisouv abortsbisovu
abortsbsoviu abortsbsovui abortsbsoivu abortsbsoiuv abortsbsouiv abortsbsouvi abortsbsvoiu abortsbsvoui abortsbsviou
abortsbsviuo abortsbsvuio abortsbsvuoi abortsbsivou abortsbsivuo abortsbsiovu abortsbsiouv abortsbsiuov abortsbsiuvo
abortsbsuvio abortsbsuvoi abortsbsuivo abortsbsuiov abortsbsuoiv abortsbsuovi abortsobuvis abortsobuvsi abortsobuivs
abortsobuisv abortsobusiv abortsobusvi abortsobvuis abortsobvusi abortsobvius abortsobvisu abortsobvsiu abortsobvsui
abortsobivus abortsobivsu abortsobiuvs abortsobiusv abortsobisuv abortsobisvu abortsobsviu abortsobsvui abortsobsivu
abortsobsiuv abortsobsuiv abortsobsuvi abortsoubvis abortsoubvsi abortsoubivs abortsoubisv abortsoubsiv abortsoubsvi
abortsouvbis abortsouvbsi abortsouvibs abortsouvisb abortsouvsib abortsouvsbi abortsouivbs abortsouivsb abortsouibvs
abortsouibsv abortsouisbv abortsouisvb abortsousvib abortsousvbi abortsousivb abortsousibv abortsousbiv abortsousbvi
abortsovubis abortsovubsi abortsovuibs abortsovuisb abortsovusib abortsovusbi abortsovbuis abortsovbusi abortsovbius
abortsovbisu abortsovbsiu abortsovbsui abortsovibus abortsovibsu abortsoviubs abortsoviusb abortsovisub abortsovisbu
abortsovsbiu abortsovsbui abortsovsibu abortsovsiub abortsovsuib abortsovsubi abortsoiuvbs abortsoiuvsb abortsoiubvs
abortsoiubsv abortsoiusbv abortsoiusvb abortsoivubs abortsoivusb abortsoivbus abortsoivbsu abortsoivsbu abortsoivsub
abortsoibvus abortsoibvsu abortsoibuvs abortsoibusv abortsoibsuv abortsoibsvu abortsoisvbu abortsoisvub abortsoisbvu
abortsoisbuv abortsoisubv abortsoisuvb abortsosuvib abortsosuvbi abortsosuivb abortsosuibv abortsosubiv abortsosubvi
abortsosvuib abortsosvubi abortsosviub abortsosvibu abortsosvbiu abortsosvbui abortsosivub abortsosivbu abortsosiuvb
abortsosiubv abortsosibuv abortsosibvu abortsosbviu abortsosbvui abortsosbivu abortsosbiuv abortsosbuiv abortsosbuvi
abortsvbouis abortsvbousi abortsvboius abortsvboisu abortsvbosiu abortsvbosui abortsvbuois abortsvbuosi abortsvbuios
abortsvbuiso abortsvbusio abortsvbusoi abortsvbiuos abortsvbiuso abortsvbious abortsvbiosu abortsvbisou abortsvbisuo
abortsvbsuio abortsvbsuoi abortsvbsiuo abortsvbsiou abortsvbsoiu abortsvbsoui abortsvobuis abortsvobusi abortsvobius
abortsvobisu abortsvobsiu abortsvobsui abortsvoubis abortsvoubsi abortsvouibs abortsvouisb abortsvousib abortsvousbi
abortsvoiubs abortsvoiusb abortsvoibus abortsvoibsu abortsvoisbu abortsvoisub abortsvosuib abortsvosubi abortsvosiub
abortsvosibu abortsvosbiu abortsvosbui abortsvuobis abortsvuobsi abortsvuoibs abortsvuoisb abortsvuosib abortsvuosbi
abortsvubois abortsvubosi abortsvubios abortsvubiso abortsvubsio abortsvubsoi abortsvuibos abortsvuibso abortsvuiobs
abortsvuiosb abortsvuisob abortsvuisbo abortsvusbio abortsvusboi abortsvusibo abortsvusiob abortsvusoib abortsvusobi
abortsvioubs abortsviousb abortsviobus abortsviobsu abortsviosbu abortsviosub abortsviuobs abortsviuosb abortsviubos
abortsviubso abortsviusbo abortsviusob abortsvibuos abortsvibuso abortsvibous abortsvibosu abortsvibsou abortsvibsuo
abortsvisubo abortsvisuob abortsvisbuo abortsvisbou abortsvisobu abortsvisoub abortsvsouib abortsvsoubi abortsvsoiub
abortsvsoibu abortsvsobiu abortsvsobui abortsvsuoib abortsvsuobi abortsvsuiob abortsvsuibo abortsvsubio abortsvsuboi
abortsvsiuob abortsvsiubo abortsvsioub abortsvsiobu abortsvsibou abortsvsibuo abortsvsbuio abortsvsbuoi abortsvsbiuo
abortsvsbiou abortsvsboiu abortsvsboui abortsibovus abortsibovsu abortsibouvs abortsibousv abortsibosuv abortsibosvu
abortsibvous abortsibvosu abortsibvuos abortsibvuso abortsibvsuo abortsibvsou abortsibuvos abortsibuvso abortsibuovs
abortsibuosv abortsibusov abortsibusvo abortsibsvuo abortsibsvou abortsibsuvo abortsibsuov abortsibsouv abortsibsovu
abortsiobvus abortsiobvsu abortsiobuvs abortsiobusv abortsiobsuv abortsiobsvu abortsiovbus abortsiovbsu abortsiovubs
abortsiovusb abortsiovsub abortsiovsbu abortsiouvbs abortsiouvsb abortsioubvs abortsioubsv abortsiousbv abortsiousvb
abortsiosvub abortsiosvbu abortsiosuvb abortsiosubv abortsiosbuv abortsiosbvu abortsivobus abortsivobsu abortsivoubs
abortsivousb abortsivosub abortsivosbu abortsivbous abortsivbosu abortsivbuos abortsivbuso abortsivbsuo abortsivbsou
abortsivubos abortsivubso abortsivuobs abortsivuosb abortsivusob abortsivusbo abortsivsbuo abortsivsbou abortsivsubo
abortsivsuob abortsivsoub abortsivsobu abortsiuovbs abortsiuovsb abortsiuobvs abortsiuobsv abortsiuosbv abortsiuosvb
abortsiuvobs abortsiuvosb abortsiuvbos abortsiuvbso abortsiuvsbo abortsiuvsob abortsiubvos abortsiubvso abortsiubovs
abortsiubosv abortsiubsov abortsiubsvo abortsiusvbo abortsiusvob abortsiusbvo abortsiusbov abortsiusobv abortsiusovb
abortsisovub abortsisovbu abortsisouvb abortsisoubv abortsisobuv abortsisobvu abortsisvoub abortsisvobu abortsisvuob
abortsisvubo abortsisvbuo abortsisvbou abortsisuvob abortsisuvbo abortsisuovb abortsisuobv abortsisubov abortsisubvo
abortsisbvuo abortsisbvou abortsisbuvo abortsisbuov abortsisbouv abortsisbovu abortssboviu abortssbovui abortssboivu
abortssboiuv abortssbouiv abortssbouvi abortssbvoiu abortssbvoui abortssbviou abortssbviuo abortssbvuio abortssbvuoi
abortssbivou abortssbivuo abortssbiovu abortssbiouv abortssbiuov abortssbiuvo abortssbuvio abortssbuvoi abortssbuivo
abortssbuiov abortssbuoiv abortssbuovi abortssobviu abortssobvui abortssobivu abortssobiuv abortssobuiv abortssobuvi
abortssovbiu abortssovbui abortssovibu abortssoviub abortssovuib abortssovubi abortssoivbu abortssoivub abortssoibvu
abortssoibuv abortssoiubv abortssoiuvb abortssouvib abortssouvbi abortssouivb abortssouibv abortssoubiv abortssoubvi
abortssvobiu abortssvobui abortssvoibu abortssvoiub abortssvouib abortssvoubi abortssvboiu abortssvboui abortssvbiou
abortssvbiuo abortssvbuio abortssvbuoi abortssvibou abortssvibuo abortssviobu abortssvioub abortssviuob abortssviubo
abortssvubio abortssvuboi abortssvuibo abortssvuiob abortssvuoib abortssvuobi abortssiovbu abortssiovub abortssiobvu
abortssiobuv abortssioubv abortssiouvb abortssivobu abortssivoub abortssivbou abortssivbuo abortssivubo abortssivuob
abortssibvou abortssibvuo abortssibovu abortssibouv abortssibuov abortssibuvo abortssiuvbo abortssiuvob abortssiubvo
abortssiubov abortssiuobv abortssiuovb abortssuovib abortssuovbi abortssuoivb abortssuoibv abortssuobiv abortssuobvi
abortssuvoib abortssuvobi abortssuviob abortssuvibo abortssuvbio abortssuvboi abortssuivob abortssuivbo abortssuiovb
abortssuiobv abortssuibov abortssuibvo abortssubvio abortssubvoi abortssubivo abortssubiov abortssuboiv abortssubovi
abortbsuovis abortbsuovsi abortbsuoivs abortbsuoisv abortbsuosiv abortbsuosvi abortbsuvois abortbsuvosi abortbsuvios
abortbsuviso abortbsuvsio abortbsuvsoi abortbsuivos abortbsuivso abortbsuiovs abortbsuiosv abortbsuisov abortbsuisvo
abortbsusvio abortbsusvoi abortbsusivo abortbsusiov abortbsusoiv abortbsusovi abortbsouvis abortbsouvsi abortbsouivs
abortbsouisv abortbsousiv abortbsousvi abortbsovuis abortbsovusi abortbsovius abortbsovisu abortbsovsiu abortbsovsui
abortbsoivus abortbsoivsu abortbsoiuvs abortbsoiusv abortbsoisuv abortbsoisvu abortbsosviu abortbsosvui abortbsosivu
abortbsosiuv abortbsosuiv abortbsosuvi abortbsvouis abortbsvousi abortbsvoius abortbsvoisu abortbsvosiu abortbsvosui
abortbsvuois abortbsvuosi abortbsvuios abortbsvuiso abortbsvusio abortbsvusoi abortbsviuos abortbsviuso abortbsvious
abortbsviosu abortbsvisou abortbsvisuo abortbsvsuio abortbsvsuoi abortbsvsiuo abortbsvsiou abortbsvsoiu abortbsvsoui
abortbsiovus abortbsiovsu abortbsiouvs abortbsiousv abortbsiosuv abortbsiosvu abortbsivous abortbsivosu abortbsivuos
abortbsivuso abortbsivsuo abortbsivsou abortbsiuvos abortbsiuvso abortbsiuovs abortbsiuosv abortbsiusov abortbsiusvo
abortbsisvuo abortbsisvou abortbsisuvo abortbsisuov abortbsisouv abortbsisovu abortbssoviu abortbssovui abortbssoivu
abortbssoiuv abortbssouiv abortbssouvi abortbssvoiu abortbssvoui abortbssviou abortbssviuo abortbssvuio abortbssvuoi
abortbssivou abortbssivuo abortbssiovu abortbssiouv abortbssiuov abortbssiuvo abortbssuvio abortbssuvoi abortbssuivo
abortbssuiov abortbssuoiv abortbssuovi abortbusovis abortbusovsi abortbusoivs abortbusoisv abortbusosiv abortbusosvi
abortbusvois abortbusvosi abortbusvios abortbusviso abortbusvsio abortbusvsoi abortbusivos abortbusivso abortbusiovs
abortbusiosv abortbusisov abortbusisvo abortbussvio abortbussvoi abortbussivo abortbussiov abortbussoiv abortbussovi
abortbuosvis abortbuosvsi abortbuosivs abortbuosisv abortbuossiv abortbuossvi abortbuovsis abortbuovssi abortbuoviss
abortbuoviss abortbuovsis abortbuovssi abortbuoivss abortbuoivss abortbuoisvs abortbuoissv abortbuoissv abortbuoisvs
abortbuosvis abortbuosvsi abortbuosivs abortbuosisv abortbuossiv abortbuossvi abortbuvosis abortbuvossi abortbuvoiss
abortbuvoiss abortbuvosis abortbuvossi abortbuvsois abortbuvsosi abortbuvsios abortbuvsiso abortbuvssio abortbuvssoi
abortbuvisos abortbuvisso abortbuvioss abortbuvioss abortbuvisos abortbuvisso abortbuvssio abortbuvssoi abortbuvsiso
abortbuvsios abortbuvsois abortbuvsosi abortbuiovss abortbuiovss abortbuiosvs abortbuiossv abortbuiossv abortbuiosvs
abortbuivoss abortbuivoss abortbuivsos abortbuivsso abortbuivsso abortbuivsos abortbuisvos abortbuisvso abortbuisovs
abortbuisosv abortbuissov abortbuissvo abortbuisvso abortbuisvos abortbuissvo abortbuissov abortbuisosv abortbuisovs
abortbusovis abortbusovsi abortbusoivs abortbusoisv abortbusosiv abortbusosvi abortbusvois abortbusvosi abortbusvios
abortbusviso abortbusvsio abortbusvsoi abortbusivos abortbusivso abortbusiovs abortbusiosv abortbusisov abortbusisvo
abortbussvio abortbussvoi abortbussivo abortbussiov abortbussoiv abortbussovi abortbousvis abortbousvsi abortbousivs
abortbousisv abortboussiv abortboussvi abortbouvsis abortbouvssi abortbouviss abortbouviss abortbouvsis abortbouvssi
abortbouivss abortbouivss abortbouisvs abortbouissv abortbouissv abortbouisvs abortbousvis abortbousvsi abortbousivs
abortbousisv abortboussiv abortboussvi abortbosuvis abortbosuvsi abortbosuivs abortbosuisv abortbosusiv abortbosusvi
abortbosvuis abortbosvusi abortbosvius abortbosvisu abortbosvsiu abortbosvsui abortbosivus abortbosivsu abortbosiuvs
abortbosiusv abortbosisuv abortbosisvu abortbossviu abortbossvui abortbossivu abortbossiuv abortbossuiv abortbossuvi
abortbovsuis abortbovsusi abortbovsius abortbovsisu abortbovssiu abortbovssui abortbovusis abortbovussi abortbovuiss
abortbovuiss abortbovusis abortbovussi abortboviuss abortboviuss abortbovisus abortbovissu abortbovissu abortbovisus
abortbovsuis abortbovsusi abortbovsius abortbovsisu abortbovssiu abortbovssui abortboisvus abortboisvsu abortboisuvs
abortboisusv abortboissuv abortboissvu abortboivsus abortboivssu abortboivuss abortboivuss abortboivsus abortboivssu
abortboiuvss abortboiuvss abortboiusvs abortboiussv abortboiussv abortboiusvs abortboisvus abortboisvsu abortboisuvs
abortboisusv abortboissuv abortboissvu abortbossviu abortbossvui abortbossivu abortbossiuv abortbossuiv abortbossuvi
abortbosvsiu abortbosvsui abortbosvisu abortbosvius abortbosvuis abortbosvusi abortbosivsu abortbosivus abortbosisvu
abortbosisuv abortbosiusv abortbosiuvs abortbosuvis abortbosuvsi abortbosuivs abortbosuisv abortbosusiv abortbosusvi
abortbvuosis abortbvuossi abortbvuoiss abortbvuoiss abortbvuosis abortbvuossi abortbvusois abortbvusosi abortbvusios
abortbvusiso abortbvussio abortbvussoi abortbvuisos abortbvuisso abortbvuioss abortbvuioss abortbvuisos abortbvuisso
abortbvussio abortbvussoi abortbvusiso abortbvusios abortbvusois abortbvusosi abortbvousis abortbvoussi abortbvouiss
abortbvouiss abortbvousis abortbvoussi abortbvosuis abortbvosusi abortbvosius abortbvosisu abortbvossiu abortbvossui
abortbvoisus abortbvoissu abortbvoiuss abortbvoiuss abortbvoisus abortbvoissu abortbvossiu abortbvossui abortbvosisu
abortbvosius abortbvosuis abortbvosusi abortbvsouis abortbvsousi abortbvsoius abortbvsoisu abortbvsosiu abortbvsosui
abortbvsuois abortbvsuosi abortbvsuios abortbvsuiso abortbvsusio abortbvsusoi abortbvsiuos abortbvsiuso abortbvsious
abortbvsiosu abortbvsisou abortbvsisuo abortbvssuio abortbvssuoi abortbvssiuo abortbvssiou abortbvssoiu abortbvssoui
abortbviosus abortbviossu abortbviouss abortbviouss abortbviosus abortbviossu abortbvisous abortbvisosu abortbvisuos
abortbvisuso abortbvissuo abortbvissou abortbviusos abortbviusso abortbviuoss abortbviuoss abortbviusos abortbviusso
abortbvissuo abortbvissou abortbvisuso abortbvisuos abortbvisous abortbvisosu abortbvsosiu abortbvsosui abortbvsoisu
abortbvsoius abortbvsouis abortbvsousi abortbvssoiu abortbvssoui abortbvssiou abortbvssiuo abortbvssuio abortbvssuoi
abortbvsisou abortbvsisuo abortbvsiosu abortbvsious abortbvsiuos abortbvsiuso abortbvsusio abortbvsusoi abortbvsuiso
abortbvsuios abortbvsuois abortbvsuosi abortbiuovss abortbiuovss abortbiuosvs abortbiuossv abortbiuossv abortbiuosvs
abortbiuvoss abortbiuvoss abortbiuvsos abortbiuvsso abortbiuvsso abortbiuvsos abortbiusvos abortbiusvso abortbiusovs
abortbiusosv abortbiussov abortbiussvo abortbiusvso abortbiusvos abortbiussvo abortbiussov abortbiusosv abortbiusovs
abortbiouvss abortbiouvss abortbiousvs abortbioussv abortbioussv abortbiousvs abortbiovuss abortbiovuss abortbiovsus
abortbiovssu abortbiovssu abortbiovsus abortbiosvus abortbiosvsu abortbiosuvs abortbiosusv abortbiossuv abortbiossvu
abortbiosvsu abortbiosvus abortbiossvu abortbiossuv abortbiosusv abortbiosuvs abortbivouss abortbivouss abortbivosus
abortbivossu abortbivossu abortbivosus abortbivuoss abortbivuoss abortbivusos abortbivusso abortbivusso abortbivusos
abortbivsuos abortbivsuso abortbivsous abortbivsosu abortbivssou abortbivssuo abortbivsuso abortbivsuos abortbivssuo
abortbivssou abortbivsosu abortbivsous abortbisovus abortbisovsu abortbisouvs abortbisousv abortbisosuv abortbisosvu
abortbisvous abortbisvosu abortbisvuos abortbisvuso abortbisvsuo abortbisvsou abortbisuvos abortbisuvso abortbisuovs
abortbisuosv abortbisusov abortbisusvo abortbissvuo abortbissvou abortbissuvo abortbissuov abortbissouv abortbissovu
abortbisovsu abortbisovus abortbisosvu abortbisosuv abortbisousv abortbisouvs abortbisvosu abortbisvous abortbisvsou
abortbisvsuo abortbisvuso abortbisvuos abortbissvou abortbissvuo abortbissovu abortbissouv abortbissuov abortbissuvo
abortbisuvso abortbisuvos abortbisusvo abortbisusov abortbisuosv abortbisuovs abortbsuovis abortbsuovsi abortbsuoivs
abortbsuoisv abortbsuosiv abortbsuosvi abortbsuvois abortbsuvosi abortbsuvios abortbsuviso abortbsuvsio abortbsuvsoi
abortbsuivos abortbsuivso abortbsuiovs abortbsuiosv abortbsuisov abortbsuisvo abortbsusvio abortbsusvoi abortbsusivo
abortbsusiov abortbsusoiv abortbsusovi abortbsouvis abortbsouvsi abortbsouivs abortbsouisv abortbsousiv abortbsousvi
abortbsovuis abortbsovusi abortbsovius abortbsovisu abortbsovsiu abortbsovsui abortbsoivus abortbsoivsu abortbsoiuvs
abortbsoiusv abortbsoisuv abortbsoisvu abortbsosviu abortbsosvui abortbsosivu abortbsosiuv abortbsosuiv abortbsosuvi
abortbsvouis abortbsvousi abortbsvoius abortbsvoisu abortbsvosiu abortbsvosui abortbsvuois abortbsvuosi abortbsvuios
abortbsvuiso abortbsvusio abortbsvusoi abortbsviuos abortbsviuso abortbsvious abortbsviosu abortbsvisou abortbsvisuo
abortbsvsuio abortbsvsuoi abortbsvsiuo abortbsvsiou abortbsvsoiu abortbsvsoui abortbsiovus abortbsiovsu abortbsiouvs
abortbsiousv abortbsiosuv abortbsiosvu abortbsivous abortbsivosu abortbsivuos abortbsivuso abortbsivsuo abortbsivsou
abortbsiuvos abortbsiuvso abortbsiuovs abortbsiuosv abortbsiusov abortbsiusvo abortbsisvuo abortbsisvou abortbsisuvo
abortbsisuov abortbsisouv abortbsisovu abortbssoviu abortbssovui abortbssoivu abortbssoiuv abortbssouiv abortbssouvi
abortbssvoiu abortbssvoui abortbssviou abortbssviuo abortbssvuio abortbssvuoi abortbssivou abortbssivuo abortbssiovu
abortbssiouv abortbssiuov abortbssiuvo abortbssuvio abortbssuvoi abortbssuivo abortbssuiov abortbssuoiv abortbssuovi
abortosbuvis abortosbuvsi abortosbuivs abortosbuisv abortosbusiv abortosbusvi abortosbvuis abortosbvusi abortosbvius
abortosbvisu abortosbvsiu abortosbvsui abortosbivus abortosbivsu abortosbiuvs abortosbiusv abortosbisuv abortosbisvu
abortosbsviu abortosbsvui abortosbsivu abortosbsiuv abortosbsuiv abortosbsuvi abortosubvis abortosubvsi abortosubivs
abortosubisv abortosubsiv abortosubsvi abortosuvbis abortosuvbsi abortosuvibs abortosuvisb abortosuvsib abortosuvsbi
abortosuivbs abortosuivsb abortosuibvs abortosuibsv abortosuisbv abortosuisvb abortosusvib abortosusvbi abortosusivb
abortosusibv abortosusbiv abortosusbvi abortosvubis abortosvubsi abortosvuibs abortosvuisb abortosvusib abortosvusbi
abortosvbuis abortosvbusi abortosvbius abortosvbisu abortosvbsiu abortosvbsui abortosvibus abortosvibsu abortosviubs
abortosviusb abortosvisub abortosvisbu abortosvsbiu abortosvsbui abortosvsibu abortosvsiub abortosvsuib abortosvsubi
abortosiuvbs abortosiuvsb abortosiubvs abortosiubsv abortosiusbv abortosiusvb abortosivubs abortosivusb abortosivbus
abortosivbsu abortosivsbu abortosivsub abortosibvus abortosibvsu abortosibuvs abortosibusv abortosibsuv abortosibsvu
abortosisvbu abortosisvub abortosisbvu abortosisbuv abortosisubv abortosisuvb abortossuvib abortossuvbi abortossuivb
abortossuibv abortossubiv abortossubvi abortossvuib abortossvubi abortossviub abortossvibu abortossvbiu abortossvbui
abortossivub abortossivbu abortossiuvb abortossiubv abortossibuv abortossibvu abortossbviu abortossbvui abortossbivu
abortossbiuv abortossbuiv abortossbuvi abortobsuvis abortobsuvsi abortobsuivs abortobsuisv abortobsusiv abortobsusvi
abortobsvuis abortobsvusi abortobsvius abortobsvisu abortobsvsiu abortobsvsui abortobsivus abortobsivsu abortobsiuvs
abortobsiusv abortobsisuv abortobsisvu abortobssviu abortobssvui abortobssivu abortobssiuv abortobssuiv abortobssuvi
abortobusvis abortobusvsi abortobusivs abortobusisv abortobussiv abortobussvi abortobuvsis abortobuvssi abortobuviss
abortobuviss abortobuvsis abortobuvssi abortobuivss abortobuivss abortobuisvs abortobuissv abortobuissv abortobuisvs
abortobusvis abortobusvsi abortobusivs abortobusisv abortobussiv abortobussvi abortobvusis abortobvussi abortobvuiss
abortobvuiss abortobvusis abortobvussi abortobvsuis abortobvsusi abortobvsius abortobvsisu abortobvssiu abortobvssui
abortobvisus abortobvissu abortobviuss abortobviuss abortobvisus abortobvissu abortobvssiu abortobvssui abortobvsisu
abortobvsius abortobvsuis abortobvsusi abortobiuvss abortobiuvss abortobiusvs abortobiussv abortobiussv abortobiusvs
abortobivuss abortobivuss abortobivsus abortobivssu abortobivssu abortobivsus abortobisvus abortobisvsu abortobisuvs
abortobisusv abortobissuv abortobissvu abortobisvsu abortobisvus abortobissvu abortobissuv abortobisusv abortobisuvs
abortobsuvis abortobsuvsi abortobsuivs abortobsuisv abortobsusiv abortobsusvi abortobsvuis abortobsvusi abortobsvius
abortobsvisu abortobsvsiu abortobsvsui abortobsivus abortobsivsu abortobsiuvs abortobsiusv abortobsisuv abortobsisvu
abortobssviu abortobssvui abortobssivu abortobssiuv abortobssuiv abortobssuvi abortoubsvis abortoubsvsi abortoubsivs
abortoubsisv abortoubssiv abortoubssvi abortoubvsis abortoubvssi abortoubviss abortoubviss abortoubvsis abortoubvssi
abortoubivss abortoubivss abortoubisvs abortoubissv abortoubissv abortoubisvs abortoubsvis abortoubsvsi abortoubsivs
abortoubsisv abortoubssiv abortoubssvi abortousbvis abortousbvsi abortousbivs abortousbisv abortousbsiv abortousbsvi
abortousvbis abortousvbsi abortousvibs abortousvisb abortousvsib abortousvsbi abortousivbs abortousivsb abortousibvs
abortousibsv abortousisbv abortousisvb abortoussvib abortoussvbi abortoussivb abortoussibv abortoussbiv abortoussbvi
abortouvsbis abortouvsbsi abortouvsibs abortouvsisb abortouvssib abortouvssbi abortouvbsis abortouvbssi abortouvbiss
abortouvbiss abortouvbsis abortouvbssi abortouvibss abortouvibss abortouvisbs abortouvissb abortouvissb abortouvisbs
abortouvsbis abortouvsbsi abortouvsibs abortouvsisb abortouvssib abortouvssbi abortouisvbs abortouisvsb abortouisbvs
abortouisbsv abortouissbv abortouissvb abortouivsbs abortouivssb abortouivbss abortouivbss abortouivsbs abortouivssb
abortouibvss abortouibvss abortouibsvs abortouibssv abortouibssv abortouibsvs abortouisvbs abortouisvsb abortouisbvs
abortouisbsv abortouissbv abortouissvb abortoussvib abortoussvbi abortoussivb abortoussibv abortoussbiv abortoussbvi
abortousvsib abortousvsbi abortousvisb abortousvibs abortousvbis abortousvbsi abortousivsb abortousivbs abortousisvb
abortousisbv abortousibsv abortousibvs abortousbvis abortousbvsi abortousbivs abortousbisv abortousbsiv abortousbsvi
abortovbusis abortovbussi abortovbuiss abortovbuiss abortovbusis abortovbussi abortovbsuis abortovbsusi abortovbsius
abortovbsisu abortovbssiu abortovbssui abortovbisus abortovbissu abortovbiuss abortovbiuss abortovbisus abortovbissu
abortovbssiu abortovbssui abortovbsisu abortovbsius abortovbsuis abortovbsusi abortovubsis abortovubssi abortovubiss
abortovubiss abortovubsis abortovubssi abortovusbis abortovusbsi abortovusibs abortovusisb abortovussib abortovussbi
abortovuisbs abortovuissb abortovuibss abortovuibss abortovuisbs abortovuissb abortovussib abortovussbi abortovusisb
abortovusibs abortovusbis abortovusbsi abortovsubis abortovsubsi abortovsuibs abortovsuisb abortovsusib abortovsusbi
abortovsbuis abortovsbusi abortovsbius abortovsbisu abortovsbsiu abortovsbsui abortovsibus abortovsibsu abortovsiubs
abortovsiusb abortovsisub abortovsisbu abortovssbiu abortovssbui abortovssibu abortovssiub abortovssuib abortovssubi
abortoviusbs abortoviussb abortoviubss abortoviubss abortoviusbs abortoviussb abortovisubs abortovisusb abortovisbus
abortovisbsu abortovissbu abortovissub abortovibsus abortovibssu abortovibuss abortovibuss abortovibsus abortovibssu
abortovissbu abortovissub abortovisbsu abortovisbus abortovisubs abortovisusb abortovsusib abortovsusbi abortovsuisb
abortovsuibs abortovsubis abortovsubsi abortovssuib abortovssubi abortovssiub abortovssibu abortovssbiu abortovssbui
abortovsisub abortovsisbu abortovsiusb abortovsiubs abortovsibus abortovsibsu abortovsbsiu abortovsbsui abortovsbisu
abortovsbius abortovsbuis abortovsbusi abortoibuvss abortoibuvss abortoibusvs abortoibussv abortoibussv abortoibusvs
abortoibvuss abortoibvuss abortoibvsus abortoibvssu abortoibvssu abortoibvsus abortoibsvus abortoibsvsu abortoibsuvs
abortoibsusv abortoibssuv abortoibssvu abortoibsvsu abortoibsvus abortoibssvu abortoibssuv abortoibsusv abortoibsuvs
abortoiubvss abortoiubvss abortoiubsvs abortoiubssv abortoiubssv abortoiubsvs abortoiuvbss abortoiuvbss abortoiuvsbs
abortoiuvssb abortoiuvssb abortoiuvsbs abortoiusvbs abortoiusvsb abortoiusbvs abortoiusbsv abortoiussbv abortoiussvb
abortoiusvsb abortoiusvbs abortoiussvb abortoiussbv abortoiusbsv abortoiusbvs abortoivubss abortoivubss abortoivusbs
abortoivussb abortoivussb abortoivusbs abortoivbuss abortoivbuss abortoivbsus abortoivbssu abortoivbssu abortoivbsus
abortoivsbus abortoivsbsu abortoivsubs abortoivsusb abortoivssub abortoivssbu abortoivsbsu abortoivsbus abortoivssbu
abortoivssub abortoivsusb abortoivsubs abortoisuvbs abortoisuvsb abortoisubvs abortoisubsv abortoisusbv abortoisusvb
abortoisvubs abortoisvusb abortoisvbus abortoisvbsu abortoisvsbu abortoisvsub abortoisbvus abortoisbvsu abortoisbuvs
abortoisbusv abortoisbsuv abortoisbsvu abortoissvbu abortoissvub abortoissbvu abortoissbuv abortoissubv abortoissuvb
abortoisuvsb abortoisuvbs abortoisusvb abortoisusbv abortoisubsv abortoisubvs abortoisvusb abortoisvubs abortoisvsub
abortoisvsbu abortoisvbsu abortoisvbus abortoissvub abortoissvbu abortoissuvb abortoissubv abortoissbuv abortoissbvu
abortoisbvsu abortoisbvus abortoisbsvu abortoisbsuv abortoisbusv abortoisbuvs abortosbuvis abortosbuvsi abortosbuivs
abortosbuisv abortosbusiv abortosbusvi abortosbvuis abortosbvusi abortosbvius abortosbvisu abortosbvsiu abortosbvsui
abortosbivus abortosbivsu abortosbiuvs abortosbiusv abortosbisuv abortosbisvu abortosbsviu abortosbsvui abortosbsivu
abortosbsiuv abortosbsuiv abortosbsuvi abortosubvis abortosubvsi abortosubivs abortosubisv abortosubsiv abortosubsvi
abortosuvbis abortosuvbsi abortosuvibs abortosuvisb abortosuvsib abortosuvsbi abortosuivbs abortosuivsb abortosuibvs
abortosuibsv abortosuisbv abortosuisvb abortosusvib abortosusvbi abortosusivb abortosusibv abortosusbiv abortosusbvi
abortosvubis abortosvubsi abortosvuibs abortosvuisb abortosvusib abortosvusbi abortosvbuis abortosvbusi abortosvbius
abortosvbisu abortosvbsiu abortosvbsui abortosvibus abortosvibsu abortosviubs abortosviusb abortosvisub abortosvisbu
abortosvsbiu abortosvsbui abortosvsibu abortosvsiub abortosvsuib abortosvsubi abortosiuvbs abortosiuvsb abortosiubvs
abortosiubsv abortosiusbv abortosiusvb abortosivubs abortosivusb abortosivbus abortosivbsu abortosivsbu abortosivsub
abortosibvus abortosibvsu abortosibuvs abortosibusv abortosibsuv abortosibsvu abortosisvbu abortosisvub abortosisbvu
abortosisbuv abortosisubv abortosisuvb abortossuvib abortossuvbi abortossuivb abortossuibv abortossubiv abortossubvi
abortossvuib abortossvubi abortossviub abortossvibu abortossvbiu abortossvbui abortossivub abortossivbu abortossiuvb
abortossiubv abortossibuv abortossibvu abortossbviu abortossbvui abortossbivu abortossbiuv abortossbuiv abortossbuvi
abortvsbouis abortvsbousi abortvsboius abortvsboisu abortvsbosiu abortvsbosui abortvsbuois abortvsbuosi abortvsbuios
abortvsbuiso abortvsbusio abortvsbusoi abortvsbiuos abortvsbiuso abortvsbious abortvsbiosu abortvsbisou abortvsbisuo
abortvsbsuio abortvsbsuoi abortvsbsiuo abortvsbsiou abortvsbsoiu abortvsbsoui abortvsobuis abortvsobusi abortvsobius
abortvsobisu abortvsobsiu abortvsobsui abortvsoubis abortvsoubsi abortvsouibs abortvsouisb abortvsousib abortvsousbi
abortvsoiubs abortvsoiusb abortvsoibus abortvsoibsu abortvsoisbu abortvsoisub abortvsosuib abortvsosubi abortvsosiub
abortvsosibu abortvsosbiu abortvsosbui abortvsuobis abortvsuobsi abortvsuoibs abortvsuoisb abortvsuosib abortvsuosbi
abortvsubois abortvsubosi abortvsubios abortvsubiso abortvsubsio abortvsubsoi abortvsuibos abortvsuibso abortvsuiobs
abortvsuiosb abortvsuisob abortvsuisbo abortvsusbio abortvsusboi abortvsusibo abortvsusiob abortvsusoib abortvsusobi
abortvsioubs abortvsiousb abortvsiobus abortvsiobsu abortvsiosbu abortvsiosub abortvsiuobs abortvsiuosb abortvsiubos
abortvsiubso abortvsiusbo abortvsiusob abortvsibuos abortvsibuso abortvsibous abortvsibosu abortvsibsou abortvsibsuo
abortvsisubo abortvsisuob abortvsisbuo abortvsisbou abortvsisobu abortvsisoub abortvssouib abortvssoubi abortvssoiub
abortvssoibu abortvssobiu abortvssobui abortvssuoib abortvssuobi abortvssuiob abortvssuibo abortvssubio abortvssuboi
abortvssiuob abortvssiubo abortvssioub abortvssiobu abortvssibou abortvssibuo abortvssbuio abortvssbuoi abortvssbiuo
abortvssbiou abortvssboiu abortvssboui abortvbsouis abortvbsousi abortvbsoius abortvbsoisu abortvbsosiu abortvbsosui
abortvbsuois abortvbsuosi abortvbsuios abortvbsuiso abortvbsusio abortvbsusoi abortvbsiuos abortvbsiuso abortvbsious
abortvbsiosu abortvbsisou abortvbsisuo abortvbssuio abortvbssuoi abortvbssiuo abortvbssiou abortvbssoiu abortvbssoui
abortvbosuis abortvbosusi abortvbosius abortvbosisu abortvbossiu abortvbossui abortvbousis abortvboussi abortvbouiss
abortvbouiss abortvbousis abortvboussi abortvboiuss abortvboiuss abortvboisus abortvboissu abortvboissu abortvboisus
abortvbosuis abortvbosusi abortvbosius abortvbosisu abortvbossiu abortvbossui abortvbuosis abortvbuossi abortvbuoiss
abortvbuoiss abortvbuosis abortvbuossi abortvbusois abortvbusosi abortvbusios abortvbusiso abortvbussio abortvbussoi
abortvbuisos abortvbuisso abortvbuioss abortvbuioss abortvbuisos abortvbuisso abortvbussio abortvbussoi abortvbusiso
abortvbusios abortvbusois abortvbusosi abortvbiouss abortvbiouss abortvbiosus abortvbiossu abortvbiossu abortvbiosus
abortvbiuoss abortvbiuoss abortvbiusos abortvbiusso abortvbiusso abortvbiusos abortvbisuos abortvbisuso abortvbisous
abortvbisosu abortvbissou abortvbissuo abortvbisuso abortvbisuos abortvbissuo abortvbissou abortvbisosu abortvbisous
abortvbsouis abortvbsousi abortvbsoius abortvbsoisu abortvbsosiu abortvbsosui abortvbsuois abortvbsuosi abortvbsuios
abortvbsuiso abortvbsusio abortvbsusoi abortvbsiuos abortvbsiuso abortvbsious abortvbsiosu abortvbsisou abortvbsisuo
abortvbssuio abortvbssuoi abortvbssiuo abortvbssiou abortvbssoiu abortvbssoui abortvobsuis abortvobsusi abortvobsius
abortvobsisu abortvobssiu abortvobssui abortvobusis abortvobussi abortvobuiss abortvobuiss abortvobusis abortvobussi
abortvobiuss abortvobiuss abortvobisus abortvobissu abortvobissu abortvobisus abortvobsuis abortvobsusi abortvobsius
abortvobsisu abortvobssiu abortvobssui abortvosbuis abortvosbusi abortvosbius abortvosbisu abortvosbsiu abortvosbsui
abortvosubis abortvosubsi abortvosuibs abortvosuisb abortvosusib abortvosusbi abortvosiubs abortvosiusb abortvosibus
abortvosibsu abortvosisbu abortvosisub abortvossuib abortvossubi abortvossiub abortvossibu abortvossbiu abortvossbui
abortvousbis abortvousbsi abortvousibs abortvousisb abortvoussib abortvoussbi abortvoubsis abortvoubssi abortvoubiss
abortvoubiss abortvoubsis abortvoubssi abortvouibss abortvouibss abortvouisbs abortvouissb abortvouissb abortvouisbs
abortvousbis abortvousbsi abortvousibs abortvousisb abortvoussib abortvoussbi abortvoisubs abortvoisusb abortvoisbus
abortvoisbsu abortvoissbu abortvoissub abortvoiusbs abortvoiussb abortvoiubss abortvoiubss abortvoiusbs abortvoiussb
abortvoibuss abortvoibuss abortvoibsus abortvoibssu abortvoibssu abortvoibsus abortvoisubs abortvoisusb abortvoisbus
abortvoisbsu abortvoissbu abortvoissub abortvossuib abortvossubi abortvossiub abortvossibu abortvossbiu abortvossbui
abortvosusib abortvosusbi abortvosuisb abortvosuibs abortvosubis abortvosubsi abortvosiusb abortvosiubs abortvosisub
abortvosisbu abortvosibsu abortvosibus abortvosbuis abortvosbusi abortvosbius abortvosbisu abortvosbsiu abortvosbsui
abortvubosis abortvubossi abortvuboiss abortvuboiss abortvubosis abortvubossi abortvubsois abortvubsosi abortvubsios
abortvubsiso abortvubssio abortvubssoi abortvubisos abortvubisso abortvubioss abortvubioss abortvubisos abortvubisso
abortvubssio abortvubssoi abortvubsiso abortvubsios abortvubsois abortvubsosi abortvuobsis abortvuobssi abortvuobiss
abortvuobiss abortvuobsis abortvuobssi abortvuosbis abortvuosbsi abortvuosibs abortvuosisb abortvuossib abortvuossbi
abortvuoisbs abortvuoissb abortvuoibss abortvuoibss abortvuoisbs abortvuoissb abortvuossib abortvuossbi abortvuosisb
abortvuosibs abortvuosbis abortvuosbsi abortvusobis abortvusobsi abortvusoibs abortvusoisb abortvusosib abortvusosbi
abortvusbois abortvusbosi abortvusbios abortvusbiso abortvusbsio abortvusbsoi abortvusibos abortvusibso abortvusiobs
abortvusiosb abortvusisob abortvusisbo abortvussbio abortvussboi abortvussibo abortvussiob abortvussoib abortvussobi
abortvuiosbs abortvuiossb abortvuiobss abortvuiobss abortvuiosbs abortvuiossb abortvuisobs abortvuisosb abortvuisbos
abortvuisbso abortvuissbo abortvuissob abortvuibsos abortvuibsso abortvuiboss abortvuiboss abortvuibsos abortvuibsso
abortvuissbo abortvuissob abortvuisbso abortvuisbos abortvuisobs abortvuisosb abortvusosib abortvusosbi abortvusoisb
abortvusoibs abortvusobis abortvusobsi abortvussoib abortvussobi abortvussiob abortvussibo abortvussbio abortvussboi
abortvusisob abortvusisbo abortvusiosb abortvusiobs abortvusibos abortvusibso abortvusbsio abortvusbsoi abortvusbiso
abortvusbios abortvusbois abortvusbosi abortvibouss abortvibouss abortvibosus abortvibossu abortvibossu abortvibosus
abortvibuoss abortvibuoss abortvibusos abortvibusso abortvibusso abortvibusos abortvibsuos abortvibsuso abortvibsous
abortvibsosu abortvibssou abortvibssuo abortvibsuso abortvibsuos abortvibssuo abortvibssou abortvibsosu abortvibsous
abortviobuss abortviobuss abortviobsus abortviobssu abortviobssu abortviobsus abortvioubss abortvioubss abortviousbs
abortvioussb abortvioussb abortviousbs abortviosubs abortviosusb abortviosbus abortviosbsu abortviossbu abortviossub
abortviosusb abortviosubs abortviossub abortviossbu abortviosbsu abortviosbus abortviuobss abortviuobss abortviuosbs
abortviuossb abortviuossb abortviuosbs abortviuboss abortviuboss abortviubsos abortviubsso abortviubsso abortviubsos
abortviusbos abortviusbso abortviusobs abortviusosb abortviussob abortviussbo abortviusbso abortviusbos abortviussbo
abortviussob abortviusosb abortviusobs abortvisoubs abortvisousb abortvisobus abortvisobsu abortvisosbu abortvisosub
abortvisuobs abortvisuosb abortvisubos abortvisubso abortvisusbo abortvisusob abortvisbuos abortvisbuso abortvisbous
abortvisbosu abortvisbsou abortvisbsuo abortvissubo abortvissuob abortvissbuo abortvissbou abortvissobu abortvissoub
abortvisousb abortvisoubs abortvisosub abortvisosbu abortvisobsu abortvisobus abortvisuosb abortvisuobs abortvisusob
abortvisusbo abortvisubso abortvisubos abortvissuob abortvissubo abortvissoub abortvissobu abortvissbou abortvissbuo
abortvisbuso abortvisbuos abortvisbsuo abortvisbsou abortvisbosu abortvisbous abortvsbouis abortvsbousi abortvsboius
abortvsboisu abortvsbosiu abortvsbosui abortvsbuois abortvsbuosi abortvsbuios abortvsbuiso abortvsbusio abortvsbusoi
abortvsbiuos abortvsbiuso abortvsbious abortvsbiosu abortvsbisou abortvsbisuo abortvsbsuio abortvsbsuoi abortvsbsiuo
abortvsbsiou abortvsbsoiu abortvsbsoui abortvsobuis abortvsobusi abortvsobius abortvsobisu abortvsobsiu abortvsobsui
abortvsoubis abortvsoubsi abortvsouibs abortvsouisb abortvsousib abortvsousbi abortvsoiubs abortvsoiusb abortvsoibus
abortvsoibsu abortvsoisbu abortvsoisub abortvsosuib abortvsosubi abortvsosiub abortvsosibu abortvsosbiu abortvsosbui
abortvsuobis abortvsuobsi abortvsuoibs abortvsuoisb abortvsuosib abortvsuosbi abortvsubois abortvsubosi abortvsubios
abortvsubiso abortvsubsio abortvsubsoi abortvsuibos abortvsuibso abortvsuiobs abortvsuiosb abortvsuisob abortvsuisbo
abortvsusbio abortvsusboi abortvsusibo abortvsusiob abortvsusoib abortvsusobi abortvsioubs abortvsiousb abortvsiobus
abortvsiobsu abortvsiosbu abortvsiosub abortvsiuobs abortvsiuosb abortvsiubos abortvsiubso abortvsiusbo abortvsiusob
abortvsibuos abortvsibuso abortvsibous abortvsibosu abortvsibsou abortvsibsuo abortvsisubo abortvsisuob abortvsisbuo
abortvsisbou abortvsisobu abortvsisoub abortvssouib abortvssoubi abortvssoiub abortvssoibu abortvssobiu abortvssobui
abortvssuoib abortvssuobi abortvssuiob abortvssuibo abortvssubio abortvssuboi abortvssiuob abortvssiubo abortvssioub
abortvssiobu abortvssibou abortvssibuo abortvssbuio abortvssbuoi abortvssbiuo abortvssbiou abortvssboiu abortvssboui
abortisbovus abortisbovsu abortisbouvs abortisbousv abortisbosuv abortisbosvu abortisbvous abortisbvosu abortisbvuos
abortisbvuso abortisbvsuo abortisbvsou abortisbuvos abortisbuvso abortisbuovs abortisbuosv abortisbusov abortisbusvo
abortisbsvuo abortisbsvou abortisbsuvo abortisbsuov abortisbsouv abortisbsovu abortisobvus abortisobvsu abortisobuvs
abortisobusv abortisobsuv abortisobsvu abortisovbus abortisovbsu abortisovubs abortisovusb abortisovsub abortisovsbu
abortisouvbs abortisouvsb abortisoubvs abortisoubsv abortisousbv abortisousvb abortisosvub abortisosvbu abortisosuvb
abortisosubv abortisosbuv abortisosbvu abortisvobus abortisvobsu abortisvoubs abortisvousb abortisvosub abortisvosbu
abortisvbous abortisvbosu abortisvbuos abortisvbuso abortisvbsuo abortisvbsou abortisvubos abortisvubso abortisvuobs
abortisvuosb abortisvusob abortisvusbo abortisvsbuo abortisvsbou abortisvsubo abortisvsuob abortisvsoub abortisvsobu
abortisuovbs abortisuovsb abortisuobvs abortisuobsv abortisuosbv abortisuosvb abortisuvobs abortisuvosb abortisuvbos
abortisuvbso abortisuvsbo abortisuvsob abortisubvos abortisubvso abortisubovs abortisubosv abortisubsov abortisubsvo
abortisusvbo abortisusvob abortisusbvo abortisusbov abortisusobv abortisusovb abortissovub abortissovbu abortissouvb
abortissoubv abortissobuv abortissobvu abortissvoub abortissvobu abortissvuob abortissvubo abortissvbuo abortissvbou
abortissuvob abortissuvbo abortissuovb abortissuobv abortissubov abortissubvo abortissbvuo abortissbvou abortissbuvo
abortissbuov abortissbouv abortissbovu abortibsovus abortibsovsu abortibsouvs abortibsousv abortibsosuv abortibsosvu
abortibsvous abortibsvosu abortibsvuos abortibsvuso abortibsvsuo abortibsvsou abortibsuvos abortibsuvso abortibsuovs
abortibsuosv abortibsusov abortibsusvo abortibssvuo abortibssvou abortibssuvo abortibssuov abortibssouv abortibssovu
abortibosvus abortibosvsu abortibosuvs abortibosusv abortibossuv abortibossvu abortibovsus abortibovssu abortibovuss
abortibovuss abortibovsus abortibovssu abortibouvss abortibouvss abortibousvs abortiboussv abortiboussv abortibousvs
abortibosvus abortibosvsu abortibosuvs abortibosusv abortibossuv abortibossvu abortibvosus abortibvossu abortibvouss
abortibvouss abortibvosus abortibvossu abortibvsous abortibvsosu abortibvsuos abortibvsuso abortibvssuo abortibvssou
abortibvusos abortibvusso abortibvuoss abortibvuoss abortibvusos abortibvusso abortibvssuo abortibvssou abortibvsuso
abortibvsuos abortibvsous abortibvsosu abortibuovss abortibuovss abortibuosvs abortibuossv abortibuossv abortibuosvs
abortibuvoss abortibuvoss abortibuvsos abortibuvsso abortibuvsso abortibuvsos abortibusvos abortibusvso abortibusovs
abortibusosv abortibussov abortibussvo abortibusvso abortibusvos abortibussvo abortibussov abortibusosv abortibusovs
abortibsovus abortibsovsu abortibsouvs abortibsousv abortibsosuv abortibsosvu abortibsvous abortibsvosu abortibsvuos
abortibsvuso abortibsvsuo abortibsvsou abortibsuvos abortibsuvso abortibsuovs abortibsuosv abortibsusov abortibsusvo
abortibssvuo abortibssvou abortibssuvo abortibssuov abortibssouv abortibssovu abortiobsvus abortiobsvsu abortiobsuvs
abortiobsusv abortiobssuv abortiobssvu abortiobvsus abortiobvssu abortiobvuss abortiobvuss abortiobvsus abortiobvssu
abortiobuvss abortiobuvss abortiobusvs abortiobussv abortiobussv abortiobusvs abortiobsvus abortiobsvsu abortiobsuvs
abortiobsusv abortiobssuv abortiobssvu abortiosbvus abortiosbvsu abortiosbuvs abortiosbusv abortiosbsuv abortiosbsvu
abortiosvbus abortiosvbsu abortiosvubs abortiosvusb abortiosvsub abortiosvsbu abortiosuvbs abortiosuvsb abortiosubvs
abortiosubsv abortiosusbv abortiosusvb abortiossvub abortiossvbu abortiossuvb abortiossubv abortiossbuv abortiossbvu
abortiovsbus abortiovsbsu abortiovsubs abortiovsusb abortiovssub abortiovssbu abortiovbsus abortiovbssu abortiovbuss
abortiovbuss abortiovbsus abortiovbssu abortiovubss abortiovubss abortiovusbs abortiovussb abortiovussb abortiovusbs
abortiovsbus abortiovsbsu abortiovsubs abortiovsusb abortiovssub abortiovssbu abortiousvbs abortiousvsb abortiousbvs
abortiousbsv abortioussbv abortioussvb abortiouvsbs abortiouvssb abortiouvbss abortiouvbss abortiouvsbs abortiouvssb
abortioubvss abortioubvss abortioubsvs abortioubssv abortioubssv abortioubsvs abortiousvbs abortiousvsb abortiousbvs
abortiousbsv abortioussbv abortioussvb abortiossvub abortiossvbu abortiossuvb abortiossubv abortiossbuv abortiossbvu
abortiosvsub abortiosvsbu abortiosvusb abortiosvubs abortiosvbus abortiosvbsu abortiosuvsb abortiosuvbs abortiosusvb
abortiosusbv abortiosubsv abortiosubvs abortiosbvus abortiosbvsu abortiosbuvs abortiosbusv abortiosbsuv abortiosbsvu
abortivbosus abortivbossu abortivbouss abortivbouss abortivbosus abortivbossu abortivbsous abortivbsosu abortivbsuos
abortivbsuso abortivbssuo abortivbssou abortivbusos abortivbusso abortivbuoss abortivbuoss abortivbusos abortivbusso
abortivbssuo abortivbssou abortivbsuso abortivbsuos abortivbsous abortivbsosu abortivobsus abortivobssu abortivobuss
abortivobuss abortivobsus abortivobssu abortivosbus abortivosbsu abortivosubs abortivosusb abortivossub abortivossbu
abortivousbs abortivoussb abortivoubss abortivoubss abortivousbs abortivoussb abortivossub abortivossbu abortivosusb
abortivosubs abortivosbus abortivosbsu abortivsobus abortivsobsu abortivsoubs abortivsousb abortivsosub abortivsosbu
abortivsbous abortivsbosu abortivsbuos abortivsbuso abortivsbsuo abortivsbsou abortivsubos abortivsubso abortivsuobs
abortivsuosb abortivsusob abortivsusbo abortivssbuo abortivssbou abortivssubo abortivssuob abortivssoub abortivssobu
abortivuosbs abortivuossb abortivuobss abortivuobss abortivuosbs abortivuossb abortivusobs abortivusosb abortivusbos
abortivusbso abortivussbo abortivussob abortivubsos abortivubsso abortivuboss abortivuboss abortivubsos abortivubsso
abortivussbo abortivussob abortivusbso abortivusbos abortivusobs abortivusosb abortivsosub abortivsosbu abortivsousb
abortivsoubs abortivsobus abortivsobsu abortivssoub abortivssobu abortivssuob abortivssubo abortivssbuo abortivssbou
abortivsusob abortivsusbo abortivsuosb abortivsuobs abortivsubos abortivsubso abortivsbsuo abortivsbsou abortivsbuso
abortivsbuos abortivsbous abortivsbosu abortiubovss abortiubovss abortiubosvs abortiubossv abortiubossv abortiubosvs
abortiubvoss abortiubvoss abortiubvsos abortiubvsso abortiubvsso abortiubvsos abortiubsvos abortiubsvso abortiubsovs
abortiubsosv abortiubssov abortiubssvo abortiubsvso abortiubsvos abortiubssvo abortiubssov abortiubsosv abortiubsovs
abortiuobvss abortiuobvss abortiuobsvs abortiuobssv abortiuobssv abortiuobsvs abortiuovbss abortiuovbss abortiuovsbs
abortiuovssb abortiuovssb abortiuovsbs abortiuosvbs abortiuosvsb abortiuosbvs abortiuosbsv abortiuossbv abortiuossvb
abortiuosvsb abortiuosvbs abortiuossvb abortiuossbv abortiuosbsv abortiuosbvs abortiuvobss abortiuvobss abortiuvosbs
abortiuvossb abortiuvossb abortiuvosbs abortiuvboss abortiuvboss abortiuvbsos abortiuvbsso abortiuvbsso abortiuvbsos
abortiuvsbos abortiuvsbso abortiuvsobs abortiuvsosb abortiuvssob abortiuvssbo abortiuvsbso abortiuvsbos abortiuvssbo
abortiuvssob abortiuvsosb abortiuvsobs abortiusovbs abortiusovsb abortiusobvs abortiusobsv abortiusosbv abortiusosvb
abortiusvobs abortiusvosb abortiusvbos abortiusvbso abortiusvsbo abortiusvsob abortiusbvos abortiusbvso abortiusbovs
abortiusbosv abortiusbsov abortiusbsvo abortiussvbo abortiussvob abortiussbvo abortiussbov abortiussobv abortiussovb
abortiusovsb abortiusovbs abortiusosvb abortiusosbv abortiusobsv abortiusobvs abortiusvosb abortiusvobs abortiusvsob
abortiusvsbo abortiusvbso abortiusvbos abortiussvob abortiussvbo abortiussovb abortiussobv abortiussbov abortiussbvo
abortiusbvso abortiusbvos abortiusbsvo abortiusbsov abortiusbosv abortiusbovs abortisbovus abortisbovsu abortisbouvs
abortisbousv abortisbosuv abortisbosvu abortisbvous abortisbvosu abortisbvuos abortisbvuso abortisbvsuo abortisbvsou
abortisbuvos abortisbuvso abortisbuovs abortisbuosv abortisbusov abortisbusvo abortisbsvuo abortisbsvou abortisbsuvo
abortisbsuov abortisbsouv abortisbsovu abortisobvus abortisobvsu abortisobuvs abortisobusv abortisobsuv abortisobsvu
abortisovbus abortisovbsu abortisovubs abortisovusb abortisovsub abortisovsbu abortisouvbs abortisouvsb abortisoubvs
abortisoubsv abortisousbv abortisousvb abortisosvub abortisosvbu abortisosuvb abortisosubv abortisosbuv abortisosbvu
abortisvobus abortisvobsu abortisvoubs abortisvousb abortisvosub abortisvosbu abortisvbous abortisvbosu abortisvbuos
abortisvbuso abortisvbsuo abortisvbsou abortisvubos abortisvubso abortisvuobs abortisvuosb abortisvusob abortisvusbo
abortisvsbuo abortisvsbou abortisvsubo abortisvsuob abortisvsoub abortisvsobu abortisuovbs abortisuovsb abortisuobvs
abortisuobsv abortisuosbv abortisuosvb abortisuvobs abortisuvosb abortisuvbos abortisuvbso abortisuvsbo abortisuvsob
abortisubvos abortisubvso abortisubovs abortisubosv abortisubsov abortisubsvo abortisusvbo abortisusvob abortisusbvo
abortisusbov abortisusobv abortisusovb abortissovub abortissovbu abortissouvb abortissoubv abortissobuv abortissobvu
abortissvoub abortissvobu abortissvuob abortissvubo abortissvbuo abortissvbou abortissuvob abortissuvbo abortissuovb
abortissuobv abortissubov abortissubvo abortissbvuo abortissbvou abortissbuvo abortissbuov abortissbouv abortissbovu
abortssboviu abortssbovui abortssboivu abortssboiuv abortssbouiv abortssbouvi abortssbvoiu abortssbvoui abortssbviou
abortssbviuo abortssbvuio abortssbvuoi abortssbivou abortssbivuo abortssbiovu abortssbiouv abortssbiuov abortssbiuvo
abortssbuvio abortssbuvoi abortssbuivo abortssbuiov abortssbuoiv abortssbuovi abortssobviu abortssobvui abortssobivu
abortssobiuv abortssobuiv abortssobuvi abortssovbiu abortssovbui abortssovibu abortssoviub abortssovuib abortssovubi
abortssoivbu abortssoivub abortssoibvu abortssoibuv abortssoiubv abortssoiuvb abortssouvib abortssouvbi abortssouivb
abortssouibv abortssoubiv abortssoubvi abortssvobiu abortssvobui abortssvoibu abortssvoiub abortssvouib abortssvoubi
abortssvboiu abortssvboui abortssvbiou abortssvbiuo abortssvbuio abortssvbuoi abortssvibou abortssvibuo abortssviobu
abortssvioub abortssviuob abortssviubo abortssvubio abortssvuboi abortssvuibo abortssvuiob abortssvuoib abortssvuobi
abortssiovbu abortssiovub abortssiobvu abortssiobuv abortssioubv abortssiouvb abortssivobu abortssivoub abortssivbou
abortssivbuo abortssivubo abortssivuob abortssibvou abortssibvuo abortssibovu abortssibouv abortssibuov abortssibuvo
abortssiuvbo abortssiuvob abortssiubvo abortssiubov abortssiuobv abortssiuovb abortssuovib abortssuovbi abortssuoivb
abortssuoibv abortssuobiv abortssuobvi abortssuvoib abortssuvobi abortssuviob abortssuvibo abortssuvbio abortssuvboi
abortssuivob abortssuivbo abortssuiovb abortssuiobv abortssuibov abortssuibvo abortssubvio abortssubvoi abortssubivo
abortssubiov abortssuboiv abortssubovi abortsbsoviu abortsbsovui abortsbsoivu abortsbsoiuv abortsbsouiv abortsbsouvi
abortsbsvoiu abortsbsvoui abortsbsviou abortsbsviuo abortsbsvuio abortsbsvuoi abortsbsivou abortsbsivuo abortsbsiovu
abortsbsiouv abortsbsiuov abortsbsiuvo abortsbsuvio abortsbsuvoi abortsbsuivo abortsbsuiov abortsbsuoiv abortsbsuovi
abortsbosviu abortsbosvui abortsbosivu abortsbosiuv abortsbosuiv abortsbosuvi abortsbovsiu abortsbovsui abortsbovisu
abortsbovius abortsbovuis abortsbovusi abortsboivsu abortsboivus abortsboisvu abortsboisuv abortsboiusv abortsboiuvs
abortsbouvis abortsbouvsi abortsbouivs abortsbouisv abortsbousiv abortsbousvi abortsbvosiu abortsbvosui abortsbvoisu
abortsbvoius abortsbvouis abortsbvousi abortsbvsoiu abortsbvsoui abortsbvsiou abortsbvsiuo abortsbvsuio abortsbvsuoi
abortsbvisou abortsbvisuo abortsbviosu abortsbvious abortsbviuos abortsbviuso abortsbvusio abortsbvusoi abortsbvuiso
abortsbvuios abortsbvuois abortsbvuosi abortsbiovsu abortsbiovus abortsbiosvu abortsbiosuv abortsbiousv abortsbiouvs
abortsbivosu abortsbivous abortsbivsou abortsbivsuo abortsbivuso abortsbivuos abortsbisvou abortsbisvuo abortsbisovu
abortsbisouv abortsbisuov abortsbisuvo abortsbiuvso abortsbiuvos abortsbiusvo abortsbiusov abortsbiuosv abortsbiuovs
abortsbuovis abortsbuovsi abortsbuoivs abortsbuoisv abortsbuosiv abortsbuosvi abortsbuvois abortsbuvosi abortsbuvios
abortsbuviso abortsbuvsio abortsbuvsoi abortsbuivos abortsbuivso abortsbuiovs abortsbuiosv abortsbuisov abortsbuisvo
abortsbusvio abortsbusvoi abortsbusivo abortsbusiov abortsbusoiv abortsbusovi abortsobsviu abortsobsvui abortsobsivu
abortsobsiuv abortsobsuiv abortsobsuvi abortsobvsiu abortsobvsui abortsobvisu abortsobvius abortsobvuis abortsobvusi
abortsobivsu abortsobivus abortsobisvu abortsobisuv abortsobiusv abortsobiuvs abortsobuvis abortsobuvsi abortsobuivs
abortsobuisv abortsobusiv abortsobusvi abortsosbviu abortsosbvui abortsosbivu abortsosbiuv abortsosbuiv abortsosbuvi
abortsosvbiu abortsosvbui abortsosvibu abortsosviub abortsosvuib abortsosvubi abortsosivbu abortsosivub abortsosibvu
abortsosibuv abortsosiubv abortsosiuvb abortsosuvib abortsosuvbi abortsosuivb abortsosuibv abortsosubiv abortsosubvi
abortsovsbiu abortsovsbui abortsovsibu abortsovsiub abortsovsuib abortsovsubi abortsovbsiu abortsovbsui abortsovbisu
abortsovbius abortsovbuis abortsovbusi abortsovibsu abortsovibus abortsovisbu abortsovisub abortsoviusb abortsoviubs
abortsovubis abortsovubsi abortsovuibs abortsovuisb abortsovusib abortsovusbi abortsoisvbu abortsoisvub abortsoisbvu
abortsoisbuv abortsoisubv abortsoisuvb abortsoivsbu abortsoivsub abortsoivbsu abortsoivbus abortsoivubs abortsoivusb
abortsoibvsu abortsoibvus abortsoibsvu abortsoibsuv abortsoibusv abortsoibuvs abortsoiuvbs abortsoiuvsb abortsoiubvs
abortsoiubsv abortsoiusbv abortsoiusvb abortsousvib abortsousvbi abortsousivb abortsousibv abortsousbiv abortsousbvi
abortsouvsib abortsouvsbi abortsouvisb abortsouvibs abortsouvbis abortsouvbsi abortsouivsb abortsouivbs abortsouisvb
abortsouisbv abortsouibsv abortsouibvs abortsoubvis abortsoubvsi abortsoubivs abortsoubisv abortsoubsiv abortsoubsvi
abortsvbosiu abortsvbosui abortsvboisu abortsvboius abortsvbouis abortsvbousi abortsvbsoiu abortsvbsoui abortsvbsiou
abortsvbsiuo abortsvbsuio abortsvbsuoi abortsvbisou abortsvbisuo abortsvbiosu abortsvbious abortsvbiuos abortsvbiuso
abortsvbusio abortsvbusoi abortsvbuiso abortsvbuios abortsvbuois abortsvbuosi abortsvobsiu abortsvobsui abortsvobisu
abortsvobius abortsvobuis abortsvobusi abortsvosbiu abortsvosbui abortsvosibu abortsvosiub abortsvosuib abortsvosubi
abortsvoisbu abortsvoisub abortsvoibsu abortsvoibus abortsvoiubs abortsvoiusb abortsvousib abortsvousbi abortsvouisb
abortsvouibs abortsvoubis abortsvoubsi abortsvsobiu abortsvsobui abortsvsoibu abortsvsoiub abortsvsouib abortsvsoubi
abortsvsboiu abortsvsboui abortsvsbiou abortsvsbiuo abortsvsbuio abortsvsbuoi abortsvsibou abortsvsibuo abortsvsiobu
abortsvsioub abortsvsiuob abortsvsiubo abortsvsubio abortsvsuboi abortsvsuibo abortsvsuiob abortsvsuoib abortsvsuobi
abortsviosbu abortsviosub abortsviobsu abortsviobus abortsvioubs abortsviousb abortsvisobu abortsvisoub abortsvisbou
abortsvisbuo abortsvisubo abortsvisuob abortsvibsou abortsvibsuo abortsvibosu abortsvibous abortsvibuos abortsvibuso
abortsviusbo abortsviusob abortsviubso abortsviubos abortsviuobs abortsviuosb abortsvuosib abortsvuosbi abortsvuoisb
abortsvuoibs abortsvuobis abortsvuobsi abortsvusoib abortsvusobi abortsvusiob abortsvusibo abortsvusbio abortsvusboi
abortsvuisob abortsvuisbo abortsvuiosb abortsvuiobs abortsvuibos abortsvuibso abortsvubsio abortsvubsoi abortsvubiso
abortsvubios abortsvubois abortsvubosi abortsibovsu abortsibovus abortsibosvu abortsibosuv abortsibousv abortsibouvs
abortsibvosu abortsibvous abortsibvsou abortsibvsuo abortsibvuso abortsibvuos abortsibsvou abortsibsvuo abortsibsovu
abortsibsouv abortsibsuov abortsibsuvo abortsibuvso abortsibuvos abortsibusvo abortsibusov abortsibuosv abortsibuovs
abortsiobvsu abortsiobvus abortsiobsvu abortsiobsuv abortsiobusv abortsiobuvs abortsiovbsu abortsiovbus abortsiovsbu
abortsiovsub abortsiovusb abortsiovubs abortsiosvbu abortsiosvub abortsiosbvu abortsiosbuv abortsiosubv abortsiosuvb
abortsiouvsb abortsiouvbs abortsiousvb abortsiousbv abortsioubsv abortsioubvs abortsivobsu abortsivobus abortsivosbu
abortsivosub abortsivousb abortsivoubs abortsivbosu abortsivbous abortsivbsou abortsivbsuo abortsivbuso abortsivbuos
abortsivsbou abortsivsbuo abortsivsobu abortsivsoub abortsivsuob abortsivsubo abortsivubso abortsivubos abortsivusbo
abortsivusob abortsivuosb abortsivuobs abortsisovbu abortsisovub abortsisobvu abortsisobuv abortsisoubv abortsisouvb
abortsisvobu abortsisvoub abortsisvbou abortsisvbuo abortsisvubo abortsisvuob abortsisbvou abortsisbvuo abortsisbovu
abortsisbouv abortsisbuov abortsisbuvo abortsisuvbo abortsisuvob abortsisubvo abortsisubov abortsisuobv abortsisuovb
abortsiuovsb abortsiuovbs abortsiuosvb abortsiuosbv abortsiuobsv abortsiuobvs abortsiuvosb abortsiuvobs abortsiuvsob
abortsiuvsbo abortsiuvbso abortsiuvbos abortsiusvob abortsiusvbo abortsiusovb abortsiusobv abortsiusbov abortsiusbvo
abortsiubvso abortsiubvos abortsiubsvo abortsiubsov abortsiubosv abortsiubovs abortsubovis abortsubovsi abortsuboivs
abortsuboisv abortsubosiv abortsubosvi abortsubvois abortsubvosi abortsubvios abortsubviso abortsubvsio abortsubvsoi
abortsubivos abortsubivso abortsubiovs abortsubiosv abortsubisov abortsubisvo abortsubsvio abortsubsvoi abortsubsivo
abortsubsiov abortsubsoiv abortsubsovi abortsuobvis abortsuobvsi abortsuobivs abortsuobisv abortsuobsiv abortsuobsvi
abortsuovbis abortsuovbsi abortsuovibs abortsuovisb abortsuovsib abortsuovsbi abortsuoivbs abortsuoivsb abortsuoibvs
abortsuoibsv abortsuoisbv abortsuoisvb abortsuosvib abortsuosvbi abortsuosivb abortsuosibv abortsuosbiv abortsuosbvi
abortsuvobis abortsuvobsi abortsuvoibs abortsuvoisb abortsuvosib abortsuvosbi abortsuvbois abortsuvbosi abortsuvbios
abortsuvbiso abortsuvbsio abortsuvbsoi abortsuvibos abortsuvibso abortsuviobs abortsuviosb abortsuvisob abortsuvisbo
abortsuvsbio abortsuvsboi abortsuvsibo abortsuvsiob abortsuvsoib abortsuvsobi abortsuiovbs abortsuiovsb abortsuiobvs
abortsuiobsv abortsuiosbv abortsuiosvb abortsuivobs abortsuivosb abortsuivbos abortsuivbso abortsuivsbo abortsuivsob
abortsuibvos abortsuibvso abortsuibovs abortsuibosv abortsuibsov abortsuibsvo abortsuisvbo abortsuisvob abortsuisbvo
abortsuisbov abortsuisobv abortsuisovb abortsusovib abortsusovbi abortsusoivb abortsusoibv abortsusobiv abortsusobvi
abortsusvoib abortsusvobi abortsusviob abortsusvibo abortsusvbio abortsusvboi abortsusivob abortsusivbo abortsusiovb
abortsusiobv abortsusibov abortsusibvo abortsusbvio abortsusbvoi abortsusbivo abortsusbiov abortsusboiv abortsusbovi

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us