easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

champaks

someones

thingliness

gilmer

weckl

unimbezzled

cesserisque

karfish

formidine

darvels

masculines

oomiak

olenka

untumultuous

clumsily

mobby

rimlands

hydrocarbonate


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: abbott
cipher variations:
bccpuu cddqvv deerww effsxx fggtyy
ghhuzz hiivaa ijjwbb jkkxcc kllydd
lmmzee mnnaff noobgg oppchh pqqdii
qrrejj rssfkk sttgll tuuhmm uvvinn
vwwjoo wxxkpp xyylqq yzzmrr zaanss

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: abbott
Cipher: zyylgg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: abbott
Cipher: AAAAA AAAAB AAAAB ABBAB BAABA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: abbott
cipher variations:
bccpuubeerggbggtssbiiveebkkxqqbmmzccbqqdaabssfmm
buuhyybwwjkkbyylwwbaaniicddqvvcffshhchhuttcjjwff
cllyrrcnnaddcrrebbcttgnncvvizzcxxkllczzmxxcbbojj
deerwwdggtiidiivuudkkxggdmmzssdoobeedssfccduuhoo
dwwjaadyylmmdaanyydccpkkeffsxxehhujjejjwvvellyhh
ennatteppcffettgddevvippexxkbbezzmnnebbozzeddqll
fggtyyfiivkkfkkxwwfmmziifoobuufqqdggfuuheefwwjqq
fyylccfaanoofccpaafeermmghhuzzgjjwllgllyxxgnnajj
gppcvvgrrehhgvviffgxxkrrgzzmddgbboppgddqbbgffsnn
hiivaahkkxmmhmmzyyhoobkkhqqdwwhssfiihwwjgghyylss
haaneehccpqqheercchggtooijjwbbillynninnazzippcll
irrexxittgjjixxkhhizzmttibboffiddqrriffsddihhupp
jkkxccjmmzoojoobaajqqdmmjssfyyjuuhkkjyyliijaanuu
jccpggjeerssjggteejiivqqkllyddknnappkppcbbkrrenn
kttgzzkvvillkzzmjjkbbovvkddqhhkffsttkhhuffkjjwrr
lmmzeeloobqqlqqdcclssfooluuhaalwwjmmlaankklccpww
leeriilggtuuliivgglkkxssmnnaffmppcrrmrreddmttgpp
mvvibbmxxknnmbbollmddqxxmffsjjmhhuvvmjjwhhmllytt
noobggnqqdssnssfeenuuhqqnwwjccnyyloonccpmmneeryy
nggtkkniivwwnkkxiinmmzuuoppchhorrettottgffovvirr
oxxkddozzmppoddqnnoffszzohhullojjwxxollyjjonnavv
pqqdiipssfuupuuhggpwwjsspyyleepaanqqpeeroopggtaa
piivmmpkkxyypmmzkkpoobwwqrrejjqttgvvqvvihhqxxktt
qzzmffqbborrqffsppqhhubbqjjwnnqllyzzqnnallqppcxx
rssfkkruuhwwrwwjiiryyluuraanggrccpssrggtqqriivcc
rkkxoormmzaaroobmmrqqdyysttgllsvvixxsxxkjjszzmvv
sbbohhsddqttshhurrsjjwddsllyppsnnabbsppcnnsrrezz
tuuhmmtwwjyytyylkktaanwwtccpiiteeruutiivsstkkxee
tmmzqqtoobcctqqdootssfaauvvinnuxxkzzuzzmllubboxx
uddqjjuffsvvujjwttullyffunnarruppcddurrepputtgbb
vwwjoovyylaavaanmmvccpyyveerkkvggtwwvkkxuuvmmzgg
voobssvqqdeevssfqqvuuhccwxxkppwzzmbbwbbonnwddqzz
wffsllwhhuxxwllyvvwnnahhwppcttwrreffwttgrrwvvidd
xyylqqxaanccxccpooxeeraaxggtmmxiivyyxmmzwwxoobii
xqqduuxssfggxuuhssxwwjeeyzzmrrybboddyddqppyffsbb
yhhunnyjjwzzynnaxxyppcjjyrrevvyttghhyvvittyxxkff
zaansszccpeezeerqqzggtccziivoozkkxaazoobyyzqqdkk
zssfwwzuuhiizwwjuuzyylggabbottaddqffaffsrrahhudd
ajjwppallybbappczzarrellattgxxavvijjaxxkvvazzmhh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: abbott
Cipher: noobgg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: abbott
Cipher: 112121434444

Extended Methods:
Method #1

Plaintext: abbott
method variations:
fggtyylmmyddqrrdiivwwioo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
a b b o t t 
1 2 2 4 4 4 
1 1 1 3 4 4 
They are then read out in rows:
122444111344
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: abbott
Cipher: frtalt

Read more ...
Method #3

Plaintext: abbott
method variations:
ffqstd fqstdf qstdff
stdffq tdffqs dffqst

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: abbott

all 720 cipher variations:
abbott abbott abbtot abbtto abbtto abbtot abobtt abobtt abotbt abottb abottb
abotbt abtobt abtotb abtbot abtbto abttbo abttob abtotb abtobt abttob abttbo
abtbto abtbot abbott abbott abbtot abbtto abbtto abbtot abobtt abobtt abotbt
abottb abottb abotbt abtobt abtotb abtbot abtbto abttbo abttob abtotb abtobt
abttob abttbo abtbto abtbot aobbtt aobbtt aobtbt aobttb aobttb aobtbt aobbtt
aobbtt aobtbt aobttb aobttb aobtbt aotbbt aotbtb aotbbt aotbtb aottbb aottbb
aotbtb aotbbt aottbb aottbb aotbtb aotbbt atbobt atbotb atbbot atbbto atbtbo
atbtob atobbt atobtb atobbt atobtb atotbb atotbb atbobt atbotb atbbot atbbto
atbtbo atbtob attobb attobb attbob attbbo attbbo attbob atbotb atbobt atbtob
atbtbo atbbto atbbot atobtb atobbt atotbb atotbb atobtb atobbt attobb attobb
attbob attbbo attbbo attbob atbotb atbobt atbtob atbtbo atbbto atbbot babott
babott babtot babtto babtto babtot baobtt baobtt baotbt baottb baottb baotbt
batobt batotb batbot batbto battbo battob batotb batobt battob battbo batbto
batbot bbaott bbaott bbatot bbatto bbatto bbatot bboatt bboatt bbotat bbotta
bbotta bbotat bbtoat bbtota bbtaot bbtato bbttao bbttoa bbtota bbtoat bbttoa
bbttao bbtato bbtaot bobatt bobatt bobtat bobtta bobtta bobtat boabtt boabtt
boatbt boattb boattb boatbt botabt botatb botbat botbta bottba bottab botatb
botabt bottab bottba botbta botbat btboat btbota btbaot btbato btbtao btbtoa
btobat btobta btoabt btoatb btotab btotba btaobt btaotb btabot btabto btatbo
btatob bttoab bttoba bttaob bttabo bttbao bttboa btbota btboat btbtoa btbtao
btbato btbaot btobta btobat btotba btotab btoatb btoabt bttoba bttoab bttboa
bttbao bttabo bttaob btaotb btaobt btatob btatbo btabto btabot bbaott bbaott
bbatot bbatto bbatto bbatot bboatt bboatt bbotat bbotta bbotta bbotat bbtoat
bbtota bbtaot bbtato bbttao bbttoa bbtota bbtoat bbttoa bbttao bbtato bbtaot
babott babott babtot babtto babtto babtot baobtt baobtt baotbt baottb baottb
baotbt batobt batotb batbot batbto battbo battob batotb batobt battob battbo
batbto batbot boabtt boabtt boatbt boattb boattb boatbt bobatt bobatt bobtat
bobtta bobtta bobtat botbat botbta botabt botatb bottab bottba botbta botbat
bottba bottab botatb botabt btaobt btaotb btabot btabto btatbo btatob btoabt
btoatb btobat btobta btotba btotab btboat btbota btbaot btbato btbtao btbtoa
bttoba bttoab bttboa bttbao bttabo bttaob btaotb btaobt btatob btatbo btabto
btabot btoatb btoabt btotab btotba btobta btobat bttoab bttoba bttaob bttabo
bttbao bttboa btbota btboat btbtoa btbtao btbato btbaot obbatt obbatt obbtat
obbtta obbtta obbtat obabtt obabtt obatbt obattb obattb obatbt obtabt obtatb
obtbat obtbta obttba obttab obtatb obtabt obttab obttba obtbta obtbat obbatt
obbatt obbtat obbtta obbtta obbtat obabtt obabtt obatbt obattb obattb obatbt
obtabt obtatb obtbat obtbta obttba obttab obtatb obtabt obttab obttba obtbta
obtbat oabbtt oabbtt oabtbt oabttb oabttb oabtbt oabbtt oabbtt oabtbt oabttb
oabttb oabtbt oatbbt oatbtb oatbbt oatbtb oattbb oattbb oatbtb oatbbt oattbb
oattbb oatbtb oatbbt otbabt otbatb otbbat otbbta otbtba otbtab otabbt otabtb
otabbt otabtb otatbb otatbb otbabt otbatb otbbat otbbta otbtba otbtab ottabb
ottabb ottbab ottbba ottbba ottbab otbatb otbabt otbtab otbtba otbbta otbbat
otabtb otabbt otatbb otatbb otabtb otabbt ottabb ottabb ottbab ottbba ottbba
ottbab otbatb otbabt otbtab otbtba otbbta otbbat tbboat tbbota tbbaot tbbato
tbbtao tbbtoa tbobat tbobta tboabt tboatb tbotab tbotba tbaobt tbaotb tbabot
tbabto tbatbo tbatob tbtoab tbtoba tbtaob tbtabo tbtbao tbtboa tbboat tbbota
tbbaot tbbato tbbtao tbbtoa tbobat tbobta tboabt tboatb tbotab tbotba tbaobt
tbaotb tbabot tbabto tbatbo tbatob tbtoab tbtoba tbtaob tbtabo tbtbao tbtboa
tobbat tobbta tobabt tobatb tobtab tobtba tobbat tobbta tobabt tobatb tobtab
tobtba toabbt toabtb toabbt toabtb toatbb toatbb totbab totbba totabb totabb
totbab totbba tabobt tabotb tabbot tabbto tabtbo tabtob taobbt taobtb taobbt
taobtb taotbb taotbb tabobt tabotb tabbot tabbto tabtbo tabtob tatobb tatobb
tatbob tatbbo tatbbo tatbob ttboab ttboba ttbaob ttbabo ttbbao ttbboa ttobab
ttobba ttoabb ttoabb ttobab ttobba ttaobb ttaobb ttabob ttabbo ttabbo ttabob
ttboab ttboba ttbaob ttbabo ttbbao ttbboa tbbota tbboat tbbtoa tbbtao tbbato
tbbaot tbobta tbobat tbotba tbotab tboatb tboabt tbtoba tbtoab tbtboa tbtbao
tbtabo tbtaob tbaotb tbaobt tbatob tbatbo tbabto tbabot tbbota tbboat tbbtoa
tbbtao tbbato tbbaot tbobta tbobat tbotba tbotab tboatb tboabt tbtoba tbtoab
tbtboa tbtbao tbtabo tbtaob tbaotb tbaobt tbatob tbatbo tbabto tbabot tobbta
tobbat tobtba tobtab tobatb tobabt tobbta tobbat tobtba tobtab tobatb tobabt
totbba totbab totbba totbab totabb totabb toabtb toabbt toatbb toatbb toabtb
toabbt ttboba ttboab ttbboa ttbbao ttbabo ttbaob ttobba ttobab ttobba ttobab
ttoabb ttoabb ttboba ttboab ttbboa ttbbao ttbabo ttbaob ttaobb ttaobb ttabob
ttabbo ttabbo ttabob tabotb tabobt tabtob tabtbo tabbto tabbot taobtb taobbt
taotbb taotbb taobtb taobbt tatobb tatobb tatbob tatbbo tatbbo tatbob tabotb
tabobt tabtob tabtbo tabbto tabbot

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us